spacer

EBI Dbfetch

ID   AM910967; SV 1; linear; genomic DNA; STD; ROD; 916 BP.
XX
AC   AM910967;
XX
DT   21-JUL-2008 (Rel. 96, Created)
DT   21-JUL-2008 (Rel. 96, Last updated, Version 1)
XX
DE   Myomyscus verreauxii partial ghr gene for growth hormone receptor
XX
KW   .
XX
OS   Myomyscus verreauxii (Verreaux's white-footed rat)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Myomyscus.
XX
RN   [1]
RP   1-916
RA   Chevret P.;
RT   ;
RL   Submitted (23-NOV-2007) to the INSDC.
RL   Chevret P., Equipe Zoologie Moleculaire/IGFL, ENS de Lyon, 46 Allee
RL   d'Italie, 69364 Lyon cedex 07, FRANCE.
XX
RN   [2]
RX   DOI; 10.1186/1471-2148-8-199.
RX   PUBMED; 18616808.
RA   Lecompte E., Aplin K., Denys C., Catzeflis F., Chades M., Chevret P.;
RT   "Phylogeny and biogeography of African Murinae based on mitochondrial and
RT   nuclear gene sequences, with a new tribal classification of the subfamily";
RL   BMC Evol. Biol. 8(1):199-199(2008).
XX
DR   MD5; ef4c1a1059b20d067705df277f10492c.
DR   EuropePMC; PMC2490707; 18616808.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..916
FT                   /organism="Myomyscus verreauxii"
FT                   /mol_type="genomic DNA"
FT                   /tissue_lib="MVR1"
FT                   /db_xref="taxon:485438"
FT   CDS             <1..>916
FT                   /codon_start=2
FT                   /transl_table=1
FT                   /gene="ghr"
FT                   /product="growth hormone receptor"
FT                   /db_xref="InterPro:IPR025871"
FT                   /db_xref="UniProtKB/TrEMBL:B4ERQ9"
FT                   /protein_id="CAP45634.1"
FT                   /translation="GIHDNYKPDFYNDDSWVEFIELDIDDADVDEKTEGSDTDRLLSDD
FT                   HEKSAGILGAKDDDSGRTSCYDPDILDTDFHTSDVCDGTSEFAQPQKLKAEADLLCLDQ
FT                   KNLKNSPYEASLGSLHPSITLTVEDKPQPLLGNETESTHQLASTPMSNPTSLTNIDFYA
FT                   QVSDITPAGGVVLSPGQKIKAGIAQGNTQPEVATPCQENYSMNSAYFCESDAKKCIAVT
FT                   PRMEATSCVKPSFNQEDIYITTESLTTTAQMSETAHIAPDAEMPVPDYTTVHTVQSPRG
FT                   LILNATALPLPLPDKKKFLSSCGY"
XX
SQ   Sequence 916 BP; 257 A; 249 C; 203 G; 207 T; 0 other;
     aggcattcat gataactaca aacccgactt ctacaatgat gattcttggg ttgagttcat        60
     cgagctagat attgatgatg cagatgtgga tgagaagact gaagggtccg acacagacag       120
     gcttctaagc gatgaccatg agaaatcagc cggtatcctt ggagcaaagg atgatgattc       180
     tggacgtacc agctgttatg accctgacat tttggatact gatttccaca ccagtgacgt       240
     atgtgatggt acctcggagt ttgctcagcc acagaagtta aaagcagaag ctgatctctt       300
     gtgccttgac cagaagaacc tgaagaactc gccttatgag gcttcccttg gctctctgca       360
     cccctccatt acccttacag tggaagacaa gccacagcca cttctgggca atgaaactga       420
     gtcaacccac caactcgcct ctacaccgat gagcaatccc acgtcactga caaacattga       480
     cttttatgcc caagtaagtg acattacacc agcaggtggt gtagtccttt ccccaggcca       540
     aaagattaaa gcagggatag cccagggcaa cacccagcca gaggtggcca caccctgcca       600
     agaaaattac agcatgaaca gtgcctactt ctgtgagtca gatgccaaaa agtgcatcgc       660
     tgtgacccca cgcatggagg ccacgtcatg tgtaaaacca agctttaacc aagaggacat       720
     ttacatcacc accgaaagcc ttaccactac tgcccagatg tccgagacag cacatattgc       780
     tccagatgct gagatgcctg tcccagacta caccacggtt cacaccgtgc agtctccaag       840
     gggccttata ctcaacgcga ctgctctgcc tttgcctttg cctgacaaaa agaagtttct       900
     gtcctcgtgt ggctat                                                       916
//


spacer
spacer