spacer

EBI Dbfetch

ID   AM910965; SV 1; linear; genomic DNA; STD; ROD; 904 BP.
XX
AC   AM910965;
XX
DT   21-JUL-2008 (Rel. 96, Created)
DT   21-JUL-2008 (Rel. 96, Last updated, Version 1)
XX
DE   Mylomys dybowskii partial ghr gene for growth hormone receptor
XX
KW   .
XX
OS   Mylomys dybowskii (African groove-toothed rat)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mylomys.
XX
RN   [1]
RP   1-904
RA   Chevret P.;
RT   ;
RL   Submitted (23-NOV-2007) to the INSDC.
RL   Chevret P., Equipe Zoologie Moleculaire/IGFL, ENS de Lyon, 46 Allee
RL   d'Italie, 69364 Lyon cedex 07, FRANCE.
XX
RN   [2]
RX   DOI; 10.1186/1471-2148-8-199.
RX   PUBMED; 18616808.
RA   Lecompte E., Aplin K., Denys C., Catzeflis F., Chades M., Chevret P.;
RT   "Phylogeny and biogeography of African Murinae based on mitochondrial and
RT   nuclear gene sequences, with a new tribal classification of the subfamily";
RL   BMC Evol. Biol. 8(1):199-199(2008).
XX
DR   MD5; ac424de14b803d670f139389caa31de6.
DR   EuropePMC; PMC2490707; 18616808.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..904
FT                   /organism="Mylomys dybowskii"
FT                   /mol_type="genomic DNA"
FT                   /tissue_lib="MYL"
FT                   /db_xref="taxon:121581"
FT   CDS             <1..>904
FT                   /codon_start=2
FT                   /transl_table=1
FT                   /gene="ghr"
FT                   /product="growth hormone receptor"
FT                   /db_xref="InterPro:IPR025871"
FT                   /db_xref="UniProtKB/TrEMBL:B4ERQ7"
FT                   /protein_id="CAP45632.1"
FT                   /translation="GIHDNYKPNFYNDDSWVEFIELDIDDADEKTEGSDTDRLLNDDHE
FT                   KSAGILGAKDDDSGRTSCYDPDILDTDFHTSDVCDGTSEFAQPQKLNAEADLLCLDQKN
FT                   LKNSPYDASLGSLHPSTTLTEEDKPQPLLGSETESTHQLTSTPMNNPMSLANIDFYAQV
FT                   SDITPAGGVVLSPGQKIKAGIAQGNTQPEVATPCQENYSMNSAYFCESDAKKCIDVAPC
FT                   MEATSCVKPSFNQEDIYITTESLTTTPRMSETADTAPDTEMPVPDYTTVHTVQSPRGLI
FT                   LNATALPLPDKKKFLSSCGY"
XX
SQ   Sequence 904 BP; 254 A; 246 C; 200 G; 204 T; 0 other;
     aggcattcat gataactaca aacccaactt ctacaatgat gactcctggg tcgagttcat        60
     tgagctagat attgatgacg cggatgagaa gactgaaggg tcagacacag acagacttct       120
     aaacgatgac catgagaaat cagctggtat ccttggagca aaggatgatg attctggacg       180
     taccagctgt tatgaccctg acattttgga tactgatttc cacaccagtg acgtgtgtga       240
     tggtacctcg gagtttgctc agccacagaa gttaaatgcg gaagctgatc tcttgtgcct       300
     tgaccagaag aatctgaaga actcgcctta cgatgcttcc cttggctccc tgcacccctc       360
     cactaccctg acagaagaag ataagccaca gccacttctg ggcagtgaaa ctgagtcaac       420
     tcaccaactc acctctacac cgatgaacaa tcccatgtca ctggcaaaca ttgactttta       480
     tgcccaagta agcgacatta caccagcagg tggtgtagtc ctttctccag gccaaaagat       540
     taaggcaggt atagcccagg gcaacaccca gccggaggtg gccacgccct gccaagagaa       600
     ttacagcatg aacagtgcct acttctgtga gtcagatgcc aaaaagtgca tcgatgtggc       660
     cccttgcatg gaggccacct catgtgtaaa accaagcttt aaccaagagg acatttacat       720
     caccacagaa agccttacca ctactccccg gatgtccgag acagcagata ctgctccaga       780
     tactgagatg cctgtcccag actacaccac ggttcacacc gtgcagtctc caaggggcct       840
     tatactcaac gcgactgctt tgcctttgcc tgacaaaaag aagtttctct cctcgtgtgg       900
     ctat                                                                    904
//


spacer
spacer