spacer

EBI Dbfetch

ID   AM910961; SV 1; linear; genomic DNA; STD; ROD; 916 BP.
XX
AC   AM910961;
XX
DT   21-JUL-2008 (Rel. 96, Created)
DT   21-JUL-2008 (Rel. 96, Last updated, Version 1)
XX
DE   Mastomys kollmannspergeri partial ghr gene for growth hormone receptor
XX
KW   .
XX
OS   Mastomys kollmannspergeri (Kollmannsperger's Mastomys)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mastomys.
XX
RN   [1]
RP   1-916
RA   Chevret P.;
RT   ;
RL   Submitted (23-NOV-2007) to the INSDC.
RL   Chevret P., Equipe Zoologie Moleculaire/IGFL, ENS de Lyon, 46 Allee
RL   d'Italie, 69364 Lyon cedex 07, FRANCE.
XX
RN   [2]
RX   DOI; 10.1186/1471-2148-8-199.
RX   PUBMED; 18616808.
RA   Lecompte E., Aplin K., Denys C., Catzeflis F., Chades M., Chevret P.;
RT   "Phylogeny and biogeography of African Murinae based on mitochondrial and
RT   nuclear gene sequences, with a new tribal classification of the subfamily";
RL   BMC Evol. Biol. 8(1):199-199(2008).
XX
DR   MD5; e41130acdbd34295421fe2a51f0953d4.
DR   EuropePMC; PMC2490707; 18616808.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..916
FT                   /organism="Mastomys kollmannspergeri"
FT                   /mol_type="genomic DNA"
FT                   /tissue_lib="MZA1"
FT                   /db_xref="taxon:485425"
FT   CDS             <1..>916
FT                   /codon_start=2
FT                   /transl_table=1
FT                   /gene="ghr"
FT                   /product="growth hormone receptor"
FT                   /db_xref="InterPro:IPR025871"
FT                   /db_xref="UniProtKB/TrEMBL:B4ERQ3"
FT                   /protein_id="CAP45628.1"
FT                   /translation="GIHDNYKPDFYNDDSWVEFIELDIDDADVDEKTEGSDTDRLLSDD
FT                   HENSAGILGAKDDDSGRTSCYDPDILDTDFHTSDICDGTSEFAQPQKLKAEADLLCLDQ
FT                   KNLKNLPYKASLGSLHPSITLTVEDKPQPLLGSETESTHQLASTPMSNPTSLANIDFYA
FT                   QVSDITPAGGVVLSPGQKIKAGIAQGNTQPEVATPCQENYSMNSAYFCESDAKKCIAVA
FT                   PRMEPTSCVKPSFNQEDIYITTESLTTTARMSETALIAPDAETPVPDYTTVHTVQSPRG
FT                   LILNATALPLPLPDKKKFLSSCGY"
XX
SQ   Sequence 916 BP; 253 A; 246 C; 206 G; 211 T; 0 other;
     aggcattcat gataactaca aacccgactt ctacaatgat gattcttggg ttgagttcat        60
     tgagctagat attgatgatg cagatgtgga tgagaagact gaagggtctg acacagacag       120
     acttctaagc gatgaccatg agaattcagc cggtatcctt ggagcaaagg atgatgattc       180
     tggacgtacc agctgttatg accctgacat tttggatact gatttccaca ccagtgacat       240
     atgtgatggt acctcagagt ttgctcagcc acagaagtta aaagcggaag ctgatctctt       300
     gtgccttgac cagaagaatc tgaagaactt gccttataag gcttcccttg gctctctgca       360
     cccctccatt accctgacag tggaagacaa gccacagcca cttctgggca gtgaaactga       420
     gtcaacccac caactcgcct ctacaccgat gagcaatccc acgtcactgg caaacattga       480
     cttttatgcc caagtaagtg acattacacc agcaggtggt gtagtccttt ccccaggcca       540
     aaagattaag gcagggatag cccagggcaa cacccagccg gaggtggcca caccctgcca       600
     agaaaattac agcatgaaca gtgcctactt ctgtgagtca gatgccaaaa agtgcatcgc       660
     tgtggcccca cgcatggagc ctacgtcatg tgtaaaacca agctttaacc aagaggacat       720
     ttacatcacc accgaaagcc ttaccactac tgcccggatg tccgagacag cacttattgc       780
     tccagatgct gagacacctg tcccagacta caccacggtt cacaccgtgc agtctccaag       840
     gggccttata ctcaacgcga cggctctgcc tttgcctttg cctgacaaaa agaagtttct       900
     gtcctcgtgt ggctat                                                       916
//


spacer
spacer