spacer

EBI Dbfetch

ID   AM910957; SV 1; linear; genomic DNA; STD; ROD; 910 BP.
XX
AC   AM910957;
XX
DT   21-JUL-2008 (Rel. 96, Created)
DT   21-JUL-2008 (Rel. 96, Last updated, Version 1)
XX
DE   Malacomys longipes partial ghr gene for growth hormone receptor
XX
KW   .
XX
OS   Malacomys longipes (big-eared swamp rat)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Malacomys.
XX
RN   [1]
RP   1-910
RA   Chevret P.;
RT   ;
RL   Submitted (23-NOV-2007) to the INSDC.
RL   Chevret P., Equipe Zoologie Moleculaire/IGFL, ENS de Lyon, 46 Allee
RL   d'Italie, 69364 Lyon cedex 07, FRANCE.
XX
RN   [2]
RX   DOI; 10.1186/1471-2148-8-199.
RX   PUBMED; 18616808.
RA   Lecompte E., Aplin K., Denys C., Catzeflis F., Chades M., Chevret P.;
RT   "Phylogeny and biogeography of African Murinae based on mitochondrial and
RT   nuclear gene sequences, with a new tribal classification of the subfamily";
RL   BMC Evol. Biol. 8(1):199-199(2008).
XX
DR   MD5; c2308da008fa9a35b903d6656dfbfe8e.
DR   EuropePMC; PMC2490707; 18616808.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..910
FT                   /organism="Malacomys longipes"
FT                   /mol_type="genomic DNA"
FT                   /country="Gabon:M'Passa"
FT                   /collected_by="V. Nance"
FT                   /tissue_lib="T-424"
FT                   /db_xref="taxon:112226"
FT   CDS             <1..>910
FT                   /codon_start=2
FT                   /gene="ghr"
FT                   /product="growth hormone receptor"
FT                   /db_xref="InterPro:IPR025871"
FT                   /db_xref="UniProtKB/TrEMBL:B4ERP9"
FT                   /protein_id="CAP45624.1"
FT                   /translation="GIHDNYKSDFYNDDSWVEFIELDIDDADADEKTEGSDTDRLLSDD
FT                   HEKSAGLLGAKDDDSGRTSCYDPDILDTDFHTSDMCDGTSEFAQPQKLKAEADLLCLDQ
FT                   KTLKNLPYDASGGSLHPSITLTVEDKPRSLLSSETESTHQLASTXMSNPASLANIDFYA
FT                   QVSDITPAGGVVLSPGQKIKAGIAQGNTQLEMATPCQENYSMNSAYFCESDAKKCITVA
FT                   PHTEATSCAKPSFNQEDIYITTESLTXTARMSETADTAPDAEIPVPDYTAVHTVQSPRG
FT                   LILNAMALPLPDKKKFLSSCGI"
XX
SQ   Sequence 910 BP; 255 A; 242 C; 205 G; 205 T; 3 other;
     aggcattcat gacaactaca aatctgactt ctacaatgac gattcctggg ttgagttcat        60
     tgagctagat atcgatgacg cggatgcgga tgagaagact gaaggctcag acacagacag       120
     acttctaagc gatgaccatg agaaatcagc tggtctcctt ggagcaaagg atgatgattc       180
     tggacgtacc agctgttatg accctgacat tttggatact gatttccaca ccagtgacat       240
     gtgtgatggt acctcagagt ttgctcagcc acagaagtta aaagcagaag ctgatctctt       300
     gtgccttgac cagaagactc tgaagaactt gccttacgat gcttccggtg gctctctgca       360
     cccttccatt accctgacag tggaagacaa gccacgrtca cttttgagca gtgaaactga       420
     gtcaacccac caactcgcct ctacacmgat gagcaatccc gcgtcactgg caaacattga       480
     cttttatgcc caagtaagtg acattacacc agcaggtggt gtagtccttt ccccaggcca       540
     aaagattaag gcagggatag cccaaggcaa cacccagctg gagatggcca cgccctgcca       600
     agaaaattac agcatgaaca gtgcctactt ctgtgagtca gatgccaaaa agtgcatcac       660
     tgtggcccct cacacggagg ccacgtcatg tgcaaaacca agctttaacc aagaggacat       720
     ttacatcacc acagaaagcc ttaccastac tgcccggatg tccgagacag cagatacggc       780
     tccagatgct gagatacctg tcccagacta caccgcggtt cacaccgtgc aatctccaag       840
     gggccttata ctcaatgcaa tggctttgcc tttgcctgac aaaaagaagt ttctctcctc       900
     gtgtggcatt                                                              910
//


spacer
spacer