spacer

EBI Dbfetch

ID   AM910956; SV 1; linear; genomic DNA; STD; ROD; 907 BP.
XX
AC   AM910956;
XX
DT   21-JUL-2008 (Rel. 96, Created)
DT   21-JUL-2008 (Rel. 96, Last updated, Version 1)
XX
DE   Lemniscomys striatus partial ghr gene for growth hormone receptor
XX
KW   .
XX
OS   Lemniscomys striatus (typical striped grass mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Lemniscomys.
XX
RN   [1]
RP   1-907
RA   Chevret P.;
RT   ;
RL   Submitted (23-NOV-2007) to the INSDC.
RL   Chevret P., Equipe Zoologie Moleculaire/IGFL, ENS de Lyon, 46 Allee
RL   d'Italie, 69364 Lyon cedex 07, FRANCE.
XX
RN   [2]
RX   DOI; 10.1186/1471-2148-8-199.
RX   PUBMED; 18616808.
RA   Lecompte E., Aplin K., Denys C., Catzeflis F., Chades M., Chevret P.;
RT   "Phylogeny and biogeography of African Murinae based on mitochondrial and
RT   nuclear gene sequences, with a new tribal classification of the subfamily";
RL   BMC Evol. Biol. 8(1):199-199(2008).
XX
DR   MD5; 2d18df31cfdf81ccfb157dc63f468e4f.
DR   EuropePMC; PMC2490707; 18616808.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..907
FT                   /organism="Lemniscomys striatus"
FT                   /mol_type="genomic DNA"
FT                   /country="Democratic Republic of the Congo:Tchissanga"
FT                   /collected_by="L. Granjon"
FT                   /tissue_lib="T-789"
FT                   /db_xref="taxon:121567"
FT   CDS             <1..>907
FT                   /codon_start=2
FT                   /gene="ghr"
FT                   /product="growth hormone receptor"
FT                   /db_xref="InterPro:IPR025871"
FT                   /db_xref="UniProtKB/TrEMBL:B4ERP8"
FT                   /protein_id="CAP45623.1"
FT                   /translation="GIHDNYKPDFYNDDSWVEFIELDIDDADEKTEGSDTDRLLKDDHE
FT                   KAAGILGAKDDDSGRTSCYDPDILDTDFHTSDVCDGTSEFAQPQKLNAEADLLCLDQKN
FT                   LKNSPYDDASLGSLHPSTTLTGEDKPQPLLGTETESTHQLTSTRMSNPVSLANIDFYAQ
FT                   VSDITPAGGVVLSPGQKIKAGIAQGNTQPEVATPCQENYSMNSAYFCESDAKKCIAVAP
FT                   CMEATSCVKPSFNQEDIYITTESLTTTPRMSETADTAPDTEMPVPDYTTVHTVQSPRGL
FT                   ILNATALPLPDKKKFLSSCGY"
XX
SQ   Sequence 907 BP; 250 A; 246 C; 210 G; 200 T; 1 other;
     aggcattcat gataactaca aaccagactt ctacaatgat gactcctggg tcgagttcat        60
     tgagctagat attgatgacg cggatgagaa gactgaaggg tcagacacag acagacttct       120
     aaaggacgac catgagaaag cagctggtat ccttggagca aaggatgacg attctggacg       180
     taccagctgt tatgaccctg acattttgga tactgatttc cacaccagtg acgtgtgtga       240
     tggtacctcg gagtttgctc agccacagaa gttaaatgcg gaagctgatc tcttgtgcct       300
     tgaccagaag aatctgaaga actcgcctta cgatgatgct tcccttggct ccctgcaccc       360
     ctccactacc ctgacagggg aagataagcc acagccactt ctgggcactg aaaccgagtc       420
     aacccaccaa ctcacctcta cacggatgag caatcccgtg tcactggcaa acattgactt       480
     ttatgcccaa gtaagtgaca ttacaccagc aggtggtgta gtcctttctc caggccaaaa       540
     gattaaggcg gggatagccc agggcaacac ccagccggag gtagccacgc cctgccaaga       600
     gaattacagc atgaatagtg cctacttctg tgagtcagat gccaaaaagt gcatcgctgt       660
     ggccccttgc atggaggcca crtcatgtgt aaaaccaagc tttaaccaag aggacattta       720
     catcaccaca gaaagcctta ccactactcc ccggatgtcc gagacagcag atactgctcc       780
     agatactgag atgcctgtgc cagactacac cacggttcac accgtgcagt ctccaagggg       840
     ccttatactc aacgcgactg ctttgccttt gcctgacaaa aagaagtttc tctcctcgtg       900
     tggctac                                                                 907
//


spacer
spacer