spacer

EBI Dbfetch

ID   AM910955; SV 1; linear; genomic DNA; STD; ROD; 885 BP.
XX
AC   AM910955;
XX
DT   21-JUL-2008 (Rel. 96, Created)
DT   21-JUL-2008 (Rel. 96, Last updated, Version 1)
XX
DE   Hylomyscus stella partial ghr gene for growth hormone receptor
XX
KW   .
XX
OS   Hylomyscus stella (Stella wood mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Hylomyscus.
XX
RN   [1]
RP   1-885
RA   Chevret P.;
RT   ;
RL   Submitted (23-NOV-2007) to the INSDC.
RL   Chevret P., Equipe Zoologie Moleculaire/IGFL, ENS de Lyon, 46 Allee
RL   d'Italie, 69364 Lyon cedex 07, FRANCE.
XX
RN   [2]
RX   DOI; 10.1186/1471-2148-8-199.
RX   PUBMED; 18616808.
RA   Lecompte E., Aplin K., Denys C., Catzeflis F., Chades M., Chevret P.;
RT   "Phylogeny and biogeography of African Murinae based on mitochondrial and
RT   nuclear gene sequences, with a new tribal classification of the subfamily";
RL   BMC Evol. Biol. 8(1):199-199(2008).
XX
DR   MD5; 1761a98bd1cf78dd5aa6e13f7a9725b3.
DR   EuropePMC; PMC2490707; 18616808.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..885
FT                   /organism="Hylomyscus stella"
FT                   /mol_type="genomic DNA"
FT                   /country="Burundi:Teza"
FT                   /collected_by="T. Maddalena"
FT                   /tissue_lib="T-477"
FT                   /db_xref="taxon:41265"
FT   CDS             <1..>885
FT                   /codon_start=1
FT                   /gene="ghr"
FT                   /product="growth hormone receptor"
FT                   /db_xref="InterPro:IPR025871"
FT                   /db_xref="UniProtKB/TrEMBL:B4ERP7"
FT                   /protein_id="CAP45622.1"
FT                   /translation="YNDDSWVEFIELDIDDADADEKTEGSDTDRLLSDDHEKSVGILGA
FT                   KDDDSGRTSCYDPDILDTDFHTSDICDGTSEFAQPQKLKAEADLLCLDQKNLKNSPYEA
FT                   SLDSLHPSFTLTVEDKPQPLLGSETESTYQLASTPMSNPTSLANIDFYAQVSDITPAGG
FT                   VVLSPGQKIKAGIAQGNTQLEVATPCQENYSMNSAYFCESEAKKCIAVAPRMDATSCVK
FT                   PSFNQEDIYITTESLTTTAXMSETAHIAPDAEMPVPDYTTVHTVQSPRGLILNATALPL
FT                   PLPDKKKFLSSCGY"
XX
SQ   Sequence 885 BP; 245 A; 236 C; 202 G; 201 T; 1 other;
     tacaatgatg attcttgggt cgagttcatt gagctagata ttgatgacgc agatgcggat        60
     gaaaagactg aagggtccga cacagacaga cttctaagcg atgaccatga gaaatcagtc       120
     ggtatccttg gagcaaagga tgatgactct ggacgtacca gctgttatga ccctgacatt       180
     ttggatactg atttccacac cagtgacata tgtgatggta cctcggagtt tgctcagcca       240
     cagaagttaa aagcggaagc tgatctcttg tgccttgacc agaagaatct gaagaactcg       300
     ccttatgagg cgtcgcttga ctctctgcac ccctccttta ccctgacagt ggaagacaag       360
     ccacagccac ttctgggcag tgaaactgag tcaacctacc aactcgcctc tacaccaatg       420
     agcaatccaa cgtcactggc aaacattgac ttttatgccc aagtaagtga cattacacca       480
     gcaggtggtg tagtcctttc cccaggccaa aagattaagg cagggatagc ccagggcaac       540
     acccagctgg aggtcgccac accctgccaa gaaaattaca gcatgaacag tgcctacttc       600
     tgtgagtcag aagccaaaaa gtgcatcgct gtggccccac gcatggacgc cacgtcatgt       660
     gtaaaaccaa gctttaacca agaggacatt tacatcacca ccgaaagcct taccactact       720
     gccsggatgt ccgagacagc acatattgct ccagatgctg agatgcctgt cccagactac       780
     accacggttc acaccgtgca gtctccaagg ggccttatac tcaatgcgac tgctctgcct       840
     ttgcctttgc ctgacaaaaa gaagtttttg tcctcgtgtg gctat                       885
//


spacer
spacer