spacer

EBI Dbfetch

ID   AM910954; SV 1; linear; genomic DNA; STD; ROD; 904 BP.
XX
AC   AM910954;
XX
DT   21-JUL-2008 (Rel. 96, Created)
DT   21-JUL-2008 (Rel. 96, Last updated, Version 1)
XX
DE   Hydromys chrysogaster partial ghr gene for growth hormone receptor
XX
KW   .
XX
OS   Hydromys chrysogaster (Golden-bellied Water Rat)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Hydromys.
XX
RN   [1]
RP   1-904
RA   Chevret P.;
RT   ;
RL   Submitted (23-NOV-2007) to the INSDC.
RL   Chevret P., Equipe Zoologie Moleculaire/IGFL, ENS de Lyon, 46 Allee
RL   d'Italie, 69364 Lyon cedex 07, FRANCE.
XX
RN   [2]
RX   DOI; 10.1186/1471-2148-8-199.
RX   PUBMED; 18616808.
RA   Lecompte E., Aplin K., Denys C., Catzeflis F., Chades M., Chevret P.;
RT   "Phylogeny and biogeography of African Murinae based on mitochondrial and
RT   nuclear gene sequences, with a new tribal classification of the subfamily";
RL   BMC Evol. Biol. 8(1):199-199(2008).
XX
DR   MD5; ae5dc233ccaffaff411b7d6e6823c056.
DR   EuropePMC; PMC2490707; 18616808.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..904
FT                   /organism="Hydromys chrysogaster"
FT                   /mol_type="genomic DNA"
FT                   /country="Australia:Adelaide"
FT                   /collected_by="Watts Ch"
FT                   /tissue_lib="T-535"
FT                   /db_xref="taxon:160448"
FT   CDS             <1..>904
FT                   /codon_start=2
FT                   /gene="ghr"
FT                   /product="growth hormone receptor"
FT                   /db_xref="InterPro:IPR025871"
FT                   /db_xref="UniProtKB/TrEMBL:B4ERP6"
FT                   /protein_id="CAP45621.1"
FT                   /translation="GIHDNYKSDFYNDDSWVEFIELDIDDPDEKTEGSDTDRLLSDDHE
FT                   KSAGILGAKDDDSGRTSCYDPDILDTDFHTSDMCDGTSEFAQPEMLRSETDLLCLDQKN
FT                   LKNSPYDASLGSLHPSITLTAEDKPQPLLGSETESTHQLTSTPMSNPASLANIDFYAQV
FT                   SDITPAGGVVLSPGQKIKAGIAQGNTQLEVATPCQENYSMNSAYFCESDAKKCISVAPR
FT                   MEATSCVKPSFNQEDIYITTESLTTTARMSETADTAPDAETPVPDYTTVHTVQSPRGLI
FT                   LNATALPLPDKKKFLSSCGY"
XX
SQ   Sequence 904 BP; 254 A; 242 C; 200 G; 208 T; 0 other;
     aggcattcat gacaactaca aatccgactt ctacaatgat gactcctggg ttgagttcat        60
     tgagctagat attgatgacc cggatgagaa gactgaaggg tcagacacag acagacttct       120
     aagcgatgac catgagaaat cagctggtat ccttggagca aaggatgatg attctggacg       180
     taccagctgt tatgaccctg acattttgga tactgatttc cacaccagtg acatgtgtga       240
     tggtacctcg gagtttgctc agccagagat gttaagatcg gaaactgatc tcttgtgcct       300
     tgaccagaag aatctgaaga actcgcctta tgatgcttcc cttggctctc tgcacccctc       360
     cattaccctg acagcggaag acaagccaca gccacttctg ggcagtgaaa ctgagtcaac       420
     ccaccaactc acctctacac caatgagcaa tcctgcgtca ctggcaaaca ttgactttta       480
     tgcccaagta agtgacatta caccagcagg tggtgtagtc ctttccccag gccaaaagat       540
     taaggcaggg atagcccagg gcaacaccca actggaggtg gccacaccct gccaagaaaa       600
     ttacagcatg aacagtgcct acttctgtga gtcagatgcc aaaaagtgca tctctgtggc       660
     ccctcgcatg gaggccacat catgtgtaaa accaagcttt aaccaagagg acatttacat       720
     caccacagaa agccttacca ctactgcccg gatgtctgag acagcagata ctgctccaga       780
     tgctgagaca cctgtcccag attacaccac ggttcacaca gtgcagtctc caaggggcct       840
     tatactcaac gcgactgctt tgcctttgcc tgacaaaaag aagtttctct cctcgtgtgg       900
     ctat                                                                    904
//


spacer
spacer