spacer

EBI Dbfetch

ID   AM910951; SV 1; linear; genomic DNA; STD; ROD; 904 BP.
XX
AC   AM910951;
XX
DT   21-JUL-2008 (Rel. 96, Created)
DT   21-JUL-2008 (Rel. 96, Last updated, Version 1)
XX
DE   Golunda ellioti partial ghr gene for growth hormone receptor
XX
KW   .
XX
OS   Golunda ellioti (Indian bush rat)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Golunda.
XX
RN   [1]
RP   1-904
RA   Chevret P.;
RT   ;
RL   Submitted (23-NOV-2007) to the INSDC.
RL   Chevret P., Equipe Zoologie Moleculaire/IGFL, ENS de Lyon, 46 Allee
RL   d'Italie, 69364 Lyon cedex 07, FRANCE.
XX
RN   [2]
RX   DOI; 10.1186/1471-2148-8-199.
RX   PUBMED; 18616808.
RA   Lecompte E., Aplin K., Denys C., Catzeflis F., Chades M., Chevret P.;
RT   "Phylogeny and biogeography of African Murinae based on mitochondrial and
RT   nuclear gene sequences, with a new tribal classification of the subfamily";
RL   BMC Evol. Biol. 8(1):199-199(2008).
XX
DR   MD5; 58ce58d988ed7f2505732ca891218ab6.
DR   EuropePMC; PMC2490707; 18616808.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..904
FT                   /organism="Golunda ellioti"
FT                   /mol_type="genomic DNA"
FT                   /country="India:Mudumalai, Tamild nadu"
FT                   /collected_by="F. Catzeflis"
FT                   /tissue_lib="T-843"
FT                   /db_xref="taxon:121585"
FT   CDS             <1..>904
FT                   /codon_start=2
FT                   /gene="ghr"
FT                   /product="growth hormone receptor"
FT                   /db_xref="InterPro:IPR025871"
FT                   /db_xref="UniProtKB/TrEMBL:B4ERP3"
FT                   /protein_id="CAP45618.1"
FT                   /translation="GIHDNYKPDFYNDDSWVEFIELDIDDADEKTEGSDTDRLLSDDHE
FT                   KSAGILGAKDDDSGRTSCYDPDILDTDFHTSDTCDGTSEFAQPQKLNAEXDLLCLDQKN
FT                   LKNSPYDASLGSLHPSITLTGEDKPQPLLGHETESIHQLTSTPMSNPASLANIDFYAQV
FT                   SDITPAGGVVLSPGQKIKXGIAQGNTQPEMATPCQENYSMNSAYFCESDAKKCIAVAPC
FT                   MEATSCVKPSFNQEDIYITTESLTTTPRMSESADTAPDAEMPVPDYTTVHTVQSPRGLI
FT                   LNATALPLPDKKKFLSSCGY"
XX
SQ   Sequence 904 BP; 250 A; 248 C; 201 G; 203 T; 2 other;
     aggcattcat gataactaca aacctgactt ctacaatgat gactcctggg ttgagttcat        60
     tgagctagat attgatgacg cggatgagaa gacagaagga tcagacacag acagacttct       120
     aagcgatgac catgagaaat cagctggtat ccttggagca aaggatgatg attctggacg       180
     taccagctgt tatgaccctg acattttgga tactgatttc cacaccagtg acacgtgtga       240
     cggtacctcg gagtttgctc agccacagaa gttaaatgcg gaarctgatc tcttgtgcct       300
     tgaccagaag aatctcaaga actcgcctta tgatgcttcc cttggctccc tgcacccctc       360
     cattaccctg acaggggaag ataagccaca gccacttctg ggccatgaaa ctgagtcaat       420
     ccaccaactc acctctacac cgatgagcaa tcccgcgtca ctggcaaaca ttgactttta       480
     tgcccaagta agcgacatta caccagcagg tggtgtagtc ctttccccag gccaaaagat       540
     taagkcagga atagcccagg gcaacaccca gccggagatg gccacgccct gccaagagaa       600
     ttacagcatg aacagtgcct acttctgtga gtcagatgcc aaaaagtgca tcgctgtggc       660
     cccttgcatg gaggccacgt catgtgtaaa accaagcttt aaccaagagg acatttacat       720
     caccacagaa agccttacca ctactccccg gatgtccgag tcagcagata ctgctccaga       780
     tgctgagatg cctgtcccag actacaccac ggttcacacc gtgcagtctc caaggggcct       840
     tatactcaac gcgactgctt tgcctttgcc tgacaaaaag aagtttctct cctcgtgtgg       900
     ctat                                                                    904
//


spacer
spacer