spacer

EBI Dbfetch

ID   AM910950; SV 1; linear; genomic DNA; STD; ROD; 889 BP.
XX
AC   AM910950;
XX
DT   21-JUL-2008 (Rel. 96, Created)
DT   21-JUL-2008 (Rel. 96, Last updated, Version 1)
XX
DE   Dasymys incomtus partial ghr gene for growth hormone receptor
XX
KW   .
XX
OS   Dasymys incomtus (African marsh rat)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Dasymys.
XX
RN   [1]
RP   1-889
RA   Chevret P.;
RT   ;
RL   Submitted (23-NOV-2007) to the INSDC.
RL   Chevret P., Equipe Zoologie Moleculaire/IGFL, ENS de Lyon, 46 Allee
RL   d'Italie, 69364 Lyon cedex 07, FRANCE.
XX
RN   [2]
RX   DOI; 10.1186/1471-2148-8-199.
RX   PUBMED; 18616808.
RA   Lecompte E., Aplin K., Denys C., Catzeflis F., Chades M., Chevret P.;
RT   "Phylogeny and biogeography of African Murinae based on mitochondrial and
RT   nuclear gene sequences, with a new tribal classification of the subfamily";
RL   BMC Evol. Biol. 8(1):199-199(2008).
XX
DR   MD5; 44e9c34c181be4dbd8dee2b991d20b97.
DR   EuropePMC; PMC2490707; 18616808.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..889
FT                   /organism="Dasymys incomtus"
FT                   /mol_type="genomic DNA"
FT                   /country="South Africa:Tvl Ellisras, farm Klifontein"
FT                   /collected_by="G.Bronner +D.Bellars"
FT                   /tissue_lib="T-1419"
FT                   /db_xref="taxon:71173"
FT   CDS             <1..>889
FT                   /codon_start=2
FT                   /gene="ghr"
FT                   /product="growth hormone receptor"
FT                   /db_xref="InterPro:IPR025871"
FT                   /db_xref="UniProtKB/TrEMBL:B4ERP2"
FT                   /protein_id="CAP45617.1"
FT                   /translation="GIHDNYKPDFYNDDSWVEFIELDIDDADEKTEGLDTDRLLSDDHE
FT                   KSAGILGAKDDDSGRTSCYDPDILDSDFHTSDMCDGTSEFTQPQKLNEEADLLCLDQKN
FT                   LKNLPYDASLGSLHLSITLTGEDKPRPLLGSETESTHQLTSTPMSNPMSLANIDFYAQV
FT                   SDITPAGGVVLSPGQKIKAGIAQGNTQPEVATPCQENYSMNSAYFCESDAKKCIAVATS
FT                   CVKPSFNQEDIYVTTESLTTTPQMSETADTAPDTEIPVPDYTTVHTVQSPRGLILNATA
FT                   LPLPDKKKFLSSCGY"
XX
SQ   Sequence 889 BP; 254 A; 236 C; 195 G; 204 T; 0 other;
     aggcattcat gataactaca aacccgactt ctacaatgat gactcctggg ttgagttcat        60
     tgagttagat attgatgacg cggatgagaa gactgaaggg ttagacacag acagacttct       120
     aagcgatgac catgagaaat cagctggtat ccttggagca aaggatgatg attctggacg       180
     taccagctgt tatgaccctg acattttgga ttctgatttc cacaccagtg acatgtgtga       240
     tggtacctcg gagttcactc agccacagaa gttaaatgag gaagctgatc tcttgtgcct       300
     tgaccagaag aatctgaaga acttgcctta cgatgcttcc cttggctccc tgcacctctc       360
     cattacccta acaggggaag ataagccacg accacttctg ggcagtgaaa ctgagtcaac       420
     ccaccaactc acctctacac cgatgagcaa tcccatgtca ctagcaaaca ttgactttta       480
     tgcccaagta agcgacatta caccagcagg tggtgtagtc ctttctccag gccagaagat       540
     taaggcagga atagcccagg gcaacaccca gccggaggta gccacgccct gccaagagaa       600
     ttacagcatg aacagtgcct acttctgtga gtcagatgcc aaaaagtgca tcgctgtggc       660
     cacgtcatgt gtaaaaccaa gctttaacca agaggacatt tacgtcacca cagaaagcct       720
     taccactaca ccccagatgt ccgagacagc agatactgct ccagatactg agatacctgt       780
     cccagactac accacggttc acaccgtgca gtctccaagg ggccttatac tcaacgcgac       840
     tgctttgcct ttgcctgaca aaaagaagtt tctctcctca tgtggctat                   889
//


spacer
spacer