spacer

EBI Dbfetch

ID   AM910949; SV 1; linear; genomic DNA; STD; ROD; 596 BP.
XX
AC   AM910949;
XX
DT   21-JUL-2008 (Rel. 96, Created)
DT   21-JUL-2008 (Rel. 96, Last updated, Version 1)
XX
DE   Conilurus penicillatus partial ghr gene for growth hormone receptor
XX
KW   .
XX
OS   Conilurus penicillatus (brush-tailed rabbit-rat)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Conilurus.
XX
RN   [1]
RP   1-596
RA   Chevret P.;
RT   ;
RL   Submitted (23-NOV-2007) to the INSDC.
RL   Chevret P., Equipe Zoologie Moleculaire/IGFL, ENS de Lyon, 46 Allee
RL   d'Italie, 69364 Lyon cedex 07, FRANCE.
XX
RN   [2]
RX   DOI; 10.1186/1471-2148-8-199.
RX   PUBMED; 18616808.
RA   Lecompte E., Aplin K., Denys C., Catzeflis F., Chades M., Chevret P.;
RT   "Phylogeny and biogeography of African Murinae based on mitochondrial and
RT   nuclear gene sequences, with a new tribal classification of the subfamily";
RL   BMC Evol. Biol. 8(1):199-199(2008).
XX
DR   MD5; 0c6ac1aec99d706ce75b7400dbdb699a.
DR   EuropePMC; PMC2490707; 18616808.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..596
FT                   /organism="Conilurus penicillatus"
FT                   /mol_type="genomic DNA"
FT                   /country="Australia:Western Australia"
FT                   /collected_by="Watts Ch"
FT                   /tissue_lib="T-0527"
FT                   /db_xref="taxon:10127"
FT   CDS             <1..>596
FT                   /codon_start=3
FT                   /gene="ghr"
FT                   /product="growth hormone receptor"
FT                   /db_xref="InterPro:IPR025871"
FT                   /db_xref="UniProtKB/TrEMBL:B4ERP1"
FT                   /protein_id="CAP45616.1"
FT                   /translation="NLKNSPYDASLGSLHPSITLTTEDKPQPLLGSETESTHQLTSTQM
FT                   SNPASLANIDFYAQVSDITPAGGVVLSPGQKIKAGIAQGNTQLEVGTPCQENYSMNSAY
FT                   FCESDAKKCISVAPRMEATSCVKPSFNQEDIYITTESLTTTARMSETADTAPDAETPVP
FT                   DYTTVHTVQSPRGLILNATALPLPDKKKFLSSCGY"
XX
SQ   Sequence 596 BP; 165 A; 177 C; 126 G; 128 T; 0 other;
     agaatctgaa gaactcgcct tatgatgctt cccttggctc tctgcacccc tccattaccc        60
     tgacaacgga agacaagcca cagccacttc tgggcagtga aactgagtca acccaccaac       120
     tcacctctac acagatgagc aatcctgcct cactggcaaa cattgacttt tacgcccaag       180
     taagtgacat tacaccagca ggtggtgtag tcctttcccc aggccaaaag attaaggcag       240
     ggatagccca gggcaacacc cagctggagg tgggcacgcc ctgccaagaa aattacagca       300
     tgaacagtgc ctacttctgt gagtcagatg ccaaaaagtg catctctgtg gcccctcgca       360
     tggaggccac gtcatgtgta aaaccaagct ttaaccaaga ggacatttac atcaccacag       420
     aaagccttac cactactgcc cggatgtctg agacagcaga tactgctcca gatgctgaga       480
     cacctgtccc agattacacc acggttcaca cagtacagtc tccaaggggc cttatactca       540
     atgcgactgc tttgcctttg cctgacaaaa agaagtttct ctcctcgtgt ggctat           596
//


spacer
spacer