spacer

EBI Dbfetch

ID   AM910948; SV 1; linear; genomic DNA; STD; ROD; 599 BP.
XX
AC   AM910948;
XX
DT   21-JUL-2008 (Rel. 96, Created)
DT   21-JUL-2008 (Rel. 96, Last updated, Version 1)
XX
DE   Colomys goslingi partial ghr gene for growth hormone receptor
XX
KW   .
XX
OS   Colomys goslingi (African water rat)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Colomys.
XX
RN   [1]
RP   1-599
RA   Chevret P.;
RT   ;
RL   Submitted (23-NOV-2007) to the INSDC.
RL   Chevret P., Equipe Zoologie Moleculaire/IGFL, ENS de Lyon, 46 Allee
RL   d'Italie, 69364 Lyon cedex 07, FRANCE.
XX
RN   [2]
RX   DOI; 10.1186/1471-2148-8-199.
RX   PUBMED; 18616808.
RA   Lecompte E., Aplin K., Denys C., Catzeflis F., Chades M., Chevret P.;
RT   "Phylogeny and biogeography of African Murinae based on mitochondrial and
RT   nuclear gene sequences, with a new tribal classification of the subfamily";
RL   BMC Evol. Biol. 8(1):199-199(2008).
XX
DR   MD5; 689feb0032e20f89502f642e512f6f6c.
DR   EuropePMC; PMC2490707; 18616808.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..599
FT                   /organism="Colomys goslingi"
FT                   /mol_type="genomic DNA"
FT                   /tissue_lib="CGO2"
FT                   /db_xref="taxon:119564"
FT   CDS             <1..>599
FT                   /codon_start=3
FT                   /gene="ghr"
FT                   /product="growth hormone receptor"
FT                   /db_xref="InterPro:IPR025871"
FT                   /db_xref="UniProtKB/TrEMBL:B4ERP0"
FT                   /protein_id="CAP45615.1"
FT                   /translation="NLKNSPYEASLGSLHPSITLTVEDKPQPLLGSETESTHQLASTMS
FT                   NPTSLANIDFYAQVSDITPAGGVVLSPGQKIKAGIAQGNTQPEVATPCQENYSMNSAYF
FT                   CESDAKKCIAVAPCMEATSCVKPSFNQEDIYITTESLTTTARMSETAHIAPDAEMPVPD
FT                   YTTVHTVQSPRGLILNATALPLPLPDKKKFLSSCGY"
XX
SQ   Sequence 599 BP; 160 A; 181 C; 131 G; 127 T; 0 other;
     ggaatctgaa gaactcgcct tatgaggctt cccttggctc tctgcacccc tccattaccc        60
     tgacagtgga agacaagcca cagccacttc tgggcagtga aactgagtca acccaccaac       120
     tcgcctctac gatgagcaat cccacatcac tggcaaacat tgacttttat gcccaagtaa       180
     gtgacattac accagcaggt ggtgtagtcc tttccccagg ccaaaagatt aaggcaggga       240
     tagcccaggg caacacccag ccggaggtgg ccacaccctg ccaagaaaat tacagcatga       300
     acagtgccta cttctgtgag tcagatgcca aaaagtgcat cgctgtggcc ccatgcatgg       360
     aggccacgtc atgtgtaaaa ccaagcttta accaagagga catttacatc accaccgaaa       420
     gccttaccac tactgcccgg atgtccgaga cagcacatat tgctccagat gctgagatgc       480
     ctgtcccaga ctacaccacg gttcacaccg tgcagtctcc aaggggcctt atactcaacg       540
     cgactgctct gcctttgcct ttgcctgaca aaaagaagtt tctgtcctcg tgtggctat        599
//


spacer
spacer