spacer

EBI Dbfetch

ID   AM910947; SV 1; linear; genomic DNA; STD; ROD; 904 BP.
XX
AC   AM910947;
XX
DT   21-JUL-2008 (Rel. 96, Created)
DT   21-JUL-2008 (Rel. 96, Last updated, Version 1)
XX
DE   Bunomys chrysocomus partial ghr gene for growth hormone receptor
XX
KW   .
XX
OS   Bunomys chrysocomus (Common Bunomys)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Bunomys.
XX
RN   [1]
RP   1-904
RA   Chevret P.;
RT   ;
RL   Submitted (23-NOV-2007) to the INSDC.
RL   Chevret P., Equipe Zoologie Moleculaire/IGFL, ENS de Lyon, 46 Allee
RL   d'Italie, 69364 Lyon cedex 07, FRANCE.
XX
RN   [2]
RX   DOI; 10.1186/1471-2148-8-199.
RX   PUBMED; 18616808.
RA   Lecompte E., Aplin K., Denys C., Catzeflis F., Chades M., Chevret P.;
RT   "Phylogeny and biogeography of African Murinae based on mitochondrial and
RT   nuclear gene sequences, with a new tribal classification of the subfamily";
RL   BMC Evol. Biol. 8(1):199-199(2008).
XX
DR   MD5; fb64a6f9ecd43ece98b613cbed272d14.
DR   EuropePMC; PMC2490707; 18616808.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..904
FT                   /organism="Bunomys chrysocomus"
FT                   /mol_type="genomic DNA"
FT                   /country="Indonesia:Kamarora Sulawesi"
FT                   /collected_by="Manuel Ruedi"
FT                   /tissue_lib="T-1288"
FT                   /db_xref="taxon:485423"
FT   CDS             <1..>904
FT                   /codon_start=2
FT                   /transl_table=1
FT                   /gene="ghr"
FT                   /product="growth hormone receptor"
FT                   /db_xref="InterPro:IPR025871"
FT                   /db_xref="UniProtKB/TrEMBL:B4ERN9"
FT                   /protein_id="CAP45614.1"
FT                   /translation="GIHDNYKPDFYNDDSWVEFIELDIDDADEKTEESDTDRLLSDDHE
FT                   KSAGILGAKDDDSGRTSCYDPDILDTDFHTSDMCDGTSELAQQQKLKAEADLLCLDQKN
FT                   LKNSPYDASLGSLHPSITLTMEDKSQPLLGSETESXHQLASTPMSNPVSLANIDFYAQV
FT                   SDITPAGGVVLSPGQKIKAGLAQGNTKLEMAAPCQENYSMNSAYFCETDAKKCIAAAPH
FT                   MEATTRVKPSFNQEDIYITTESLTTTARMSETADTAPDAEMPVPDYTTVHTVQSPRGLI
FT                   LNATALPLPDKKKFLSSCGY"
XX
SQ   Sequence 904 BP; 252 A; 247 C; 203 G; 201 T; 1 other;
     gggcattcat gataactaca aacccgactt ctacaatgat gactcctggg ttgagttcat        60
     tgagctagat attgatgatg cggatgagaa gactgaagag tcagacaccg acagacttct       120
     cagcgatgac catgagaaat cagctggtat ccttggagca aaggatgacg attctggacg       180
     taccagctgt tatgaccctg acattttgga taccgatttc cacaccagtg acatgtgcga       240
     tggtacctcg gagcttgctc agcagcagaa gttaaaagca gaagctgatc tcttgtgcct       300
     tgaccagaag aatctgaaga actcgcctta tgatgcttcc cttggctctc tgcacccctc       360
     tattactctg acaatggaag acaaatcaca gccacttctg ggcagtgaaa ctgagtcaay       420
     ccaccaactc gcctctacac caatgagcaa tcctgtgtca ctggcaaaca ttgactttta       480
     tgcccaagta agcgacatta caccagcagg tggtgtagtc ctttctccag gccaaaagat       540
     taaggcgggg ttagcccagg gcaacaccaa gctggagatg gccgcgccct gccaagaaaa       600
     ttacagcatg aacagtgcct acttctgtga gacagatgcc aaaaagtgca tcgctgcggc       660
     ccctcacatg gaggccacga cccgtgtaaa accaagcttt aaccaagagg acatttacat       720
     caccacagaa agccttacca ctactgcccg aatgtccgag acagcagata ccgctccaga       780
     cgctgagatg cctgtcccag actacaccac ggttcacacc gtgcagtctc cacggggcct       840
     tatactcaac gcgactgctt tgcctttgcc tgacaaaaag aagtttctct cctcatgtgg       900
     ctat                                                                    904
//


spacer
spacer