Dbfetch

ID   AM910946; SV 1; linear; genomic DNA; STD; ROD; 836 BP.
XX
AC   AM910946;
XX
DT   21-JUL-2008 (Rel. 96, Created)
DT   21-JUL-2008 (Rel. 96, Last updated, Version 1)
XX
DE   Berylmys bowersi partial ghr gene for growth hormone receptor
XX
KW   .
XX
OS   Berylmys bowersi (Bower's white-toothed rat)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Berylmys.
XX
RN   [1]
RP   1-836
RA   Chevret P.;
RT   ;
RL   Submitted (23-NOV-2007) to the INSDC.
RL   Chevret P., Equipe Zoologie Moleculaire/IGFL, ENS de Lyon, 46 Allee
RL   d'Italie, 69364 Lyon cedex 07, FRANCE.
XX
RN   [2]
RX   DOI; 10.1186/1471-2148-8-199.
RX   PUBMED; 18616808.
RA   Lecompte E., Aplin K., Denys C., Catzeflis F., Chades M., Chevret P.;
RT   "Phylogeny and biogeography of African Murinae based on mitochondrial and
RT   nuclear gene sequences, with a new tribal classification of the subfamily";
RL   BMC Evol. Biol. 8(1):199-199(2008).
XX
DR   MD5; 7b103f02b28d49825cd2cde1c73e698f.
DR   EuropePMC; PMC2490707; 18616808.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..836
FT                   /organism="Berylmys bowersi"
FT                   /mol_type="genomic DNA"
FT                   /country="Viet Nam:Mochan"
FT                   /collected_by="Cao Van Sung"
FT                   /tissue_lib="T-861"
FT                   /db_xref="taxon:83759"
FT   CDS             <1..>836
FT                   /codon_start=1
FT                   /gene="ghr"
FT                   /product="growth hormone receptor"
FT                   /db_xref="InterPro:IPR025871"
FT                   /db_xref="UniProtKB/TrEMBL:B4ERN8"
FT                   /protein_id="CAP45613.1"
FT                   /translation="YNDDSWVEFIELDIDDADEKTEESDTDRLLSNDHEKSAGILGAKD
FT                   DDSGRTSCYDPDFLDTDFHTSDMCDGTSEFAQRQKLKAEADLLCLDQKSLKNSPYDASL
FT                   GSLHPSITLTMEDKPQSLLGSETESTHQLASTPMSNPVSLANIDFYAQVSDITPAGGVV
FT                   LSPGQKIKAGLAKGNTQLEVTAPCQENYNMNSAYFCESDAKKCIAAAPHMGATTCVKPS
FT                   FNQEDIYITTESLTTTARMSETADTAPDAEMPVPDYTTVHTVQSPRGLILNATALP"
XX
SQ   Sequence 836 BP; 233 A; 225 C; 193 G; 185 T; 0 other;
     tacaatgatg actcctgggt tgagttcata gagctggata ttgatgatgc ggatgagaag        60
     actgaagagt cagacaccga cagacttcta agcaatgacc atgagaaatc agctggtatc       120
     cttggagcaa aggatgacga ttctggacgt accagctgtt atgaccctga ctttttggat       180
     accgatttcc acaccagtga catgtgtgat ggtacctcgg agtttgctca gcggcagaag       240
     ttaaaagcag aagctgatct cttgtgcctt gaccagaaga gtctgaagaa ctcgccttat       300
     gatgcttccc ttggctctct gcacccctcc attaccctga caatggaaga caaaccacag       360
     tcacttctgg gcagtgaaac tgagtcaacc caccaactcg cctctacacc aatgagcaat       420
     cccgtgtcac tggcaaacat tgacttttat gcacaagtaa gcgacattac accagcaggt       480
     ggtgtagtcc tttctccagg ccaaaagatt aaggcggggt tagccaaggg caacacccag       540
     ctggaggtga ccgcgccctg ccaagaaaat tacaacatga acagtgccta cttctgtgag       600
     tcagatgcca aaaagtgcat cgctgcggcc cctcacatgg gggccacgac atgtgtaaaa       660
     ccaagcttta accaagagga catttacatc accacagaaa gccttaccac tactgcccga       720
     atgtccgaga cagcagatac cgctccagat gctgagatgc ctgtcccaga ctacaccacg       780
     gttcacaccg tgcagtctcc aaggggcctt atactcaacg cgactgcttt gccttt           836
//