spacer

EBI Dbfetch

ID   AM910944; SV 1; linear; genomic DNA; STD; ROD; 876 BP.
XX
AC   AM910944;
XX
DT   21-JUL-2008 (Rel. 96, Created)
DT   21-JUL-2008 (Rel. 96, Last updated, Version 1)
XX
DE   Arvicanthis niloticus partial ghr gene for growth hormone receptor
XX
KW   .
XX
OS   Arvicanthis niloticus (African grass rat)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Arvicanthis.
XX
RN   [1]
RP   1-876
RA   Chevret P.;
RT   ;
RL   Submitted (23-NOV-2007) to the INSDC.
RL   Chevret P., Equipe Zoologie Moleculaire/IGFL, ENS de Lyon, 46 Allee
RL   d'Italie, 69364 Lyon cedex 07, FRANCE.
XX
RN   [2]
RX   DOI; 10.1186/1471-2148-8-199.
RX   PUBMED; 18616808.
RA   Lecompte E., Aplin K., Denys C., Catzeflis F., Chades M., Chevret P.;
RT   "Phylogeny and biogeography of African Murinae based on mitochondrial and
RT   nuclear gene sequences, with a new tribal classification of the subfamily";
RL   BMC Evol. Biol. 8(1):199-199(2008).
XX
DR   MD5; 486a26eabdb881ac59757233d44b78f7.
DR   EuropePMC; PMC2490707; 18616808.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..876
FT                   /organism="Arvicanthis niloticus"
FT                   /mol_type="genomic DNA"
FT                   /country="Senegal:Bandia"
FT                   /collected_by="J.M. Duplantier"
FT                   /tissue_lib="T-0149"
FT                   /db_xref="taxon:61156"
FT   CDS             <1..>876
FT                   /codon_start=2
FT                   /gene="ghr"
FT                   /product="growth hormone receptor"
FT                   /db_xref="InterPro:IPR025871"
FT                   /db_xref="UniProtKB/TrEMBL:B4ERN6"
FT                   /protein_id="CAP45611.1"
FT                   /translation="HDNYKPDFYNDDSWVEFIELDIDDADEKTEGSDTDRLLNDDREKS
FT                   AGILGAKDDDSGRTSCYDPDILDTDFHTSDVCDGTSEFAQPQKLNAEADLLCLDQKNLK
FT                   NSPYDASLGSLTGEDKPQPLLGSETESTHQLTSTPVSNPVSLANIDFYAQVSDITPAGG
FT                   VVLSPGQKIKAGIAQGNTQPEVATPCQENYNMNSAYFCESDAKKCIAVAPCMEATSCVK
FT                   PSFNQEDIYITTESLTTTPRMSETADTAPDTEMPVPDYTTVHTVQSPRGLILNATALPL
FT                   PDKKKFLSSCG"
XX
SQ   Sequence 876 BP; 243 A; 233 C; 203 G; 196 T; 1 other;
     tcatgataac tacaaaccag acttctacaa tgatgactcc tgggtcgagt tcattgagct        60
     agatattgat gatgcggatg agaagactga agggtcagac acagacagac ttctaaacga       120
     tgaccgtgag aaatcagctg gtatccttgg agcaaaggat gacgattctg gacgtaccag       180
     ctgytatgac cctgacattt tggatactga tttccacacc agtgacgtgt gtgatggtac       240
     ctcggagttt gctcagccac agaagttaaa tgcggaagct gatctcttgt gccttgacca       300
     gaagaatctg aagaactcgc cttacgatgc ttcccttggc tccctgacag gcgaagataa       360
     gccacagcca cttctgggca gtgaaactga gtcaacccac caactcacct ctacaccggt       420
     gagcaatccc gtgtcactgg caaacattga cttttatgcc caagtaagtg acattacacc       480
     agcaggtggt gtagtccttt ctccaggcca aaagattaag gcagggatag cccagggcaa       540
     cacccagccg gaggtggcca cgccctgcca agagaattac aacatgaaca gtgcctactt       600
     ctgtgagtca gatgccaaaa agtgcatcgc tgtggcccct tgcatggagg ccacatcatg       660
     tgtaaaacca agctttaacc aagaggacat ttacatcacc acagaaagcc ttaccactac       720
     tccccggatg tccgagacag cagatactgc tccagatact gagatgcctg tcccagacta       780
     caccacggtt cacaccgtgc agtctccaag gggccttata ctcaacgcga ctgctttgcc       840
     tttgcctgac aaaaagaagt ttctctcctc gtgtgg                                 876
//


spacer
spacer