spacer

EBI Dbfetch

ID   AM910941; SV 1; linear; genomic DNA; STD; ROD; 1230 BP.
XX
AC   AM910941;
XX
DT   21-JUL-2008 (Rel. 96, Created)
DT   21-JUL-2008 (Rel. 96, Last updated, Version 1)
XX
DE   Gerbillurus paeba partial irbp gene for interphotoreceptor retinoid binding
DE   protein
XX
KW   .
XX
OS   Gerbillurus paeba
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Gerbillinae; Gerbillurus.
XX
RN   [1]
RP   1-1230
RA   Chevret P.;
RT   ;
RL   Submitted (23-NOV-2007) to the INSDC.
RL   Chevret P., Equipe Zoologie Moleculaire/IGFL, ENS de Lyon, 46 Allee
RL   d'Italie, 69364 Lyon cedex 07, FRANCE.
XX
RN   [2]
RX   DOI; 10.1186/1471-2148-8-199.
RX   PUBMED; 18616808.
RA   Lecompte E., Aplin K., Denys C., Catzeflis F., Chades M., Chevret P.;
RT   "Phylogeny and biogeography of African Murinae based on mitochondrial and
RT   nuclear gene sequences, with a new tribal classification of the subfamily";
RL   BMC Evol. Biol. 8(1):199-199(2008).
XX
DR   MD5; 669cf390452d755dd71fe34b9518fb43.
DR   EuropePMC; PMC2490707; 18616808.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1230
FT                   /organism="Gerbillurus paeba"
FT                   /mol_type="genomic DNA"
FT                   /country="South Africa"
FT                   /tissue_lib="T-1074"
FT                   /db_xref="taxon:186476"
FT   CDS             <1..>1230
FT                   /codon_start=1
FT                   /gene="irbp"
FT                   /product="interphotoreceptor retinoid binding protein"
FT                   /db_xref="GOA:B4ERN3"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:B4ERN3"
FT                   /protein_id="CAP45608.1"
FT                   /translation="LMGMQAAIEQAMKSHEILSISDPQTLAHVLTAGVQSSLNDPRLLI
FT                   SYEPSALEAPQQAPAHANLSREELLAQMQSNIRHEVLESNVGYLRVDDLPGQEVLSQLG
FT                   EFLVTHIWKQLMATSSLVLDLRHCTGGHVSGIPYVISYLYPGNTVMHVDTIYDRPSNTT
FT                   TEIWTLPKVLGERYSADKDVVVLTSGHTGGVAEDIAYILKQMRRAIVVGERTEGGALDL
FT                   QKLRIGQSDFFLTVPVSRSLGPLGGGGQTWEGSGVLPCVGTPAEQALEKALAILTLRRA
FT                   LPGVVLRLQEALQDYYTLVDRVPGLLHHLASMDYSAVVSEEDLVAKLNAGLQAVSEDPR
FT                   LLVRATGPRETSSRPETGPHDSPDATPEVPTEEAARRALVGSVFQVSVLPGNVGYLRFD
FT                   RFADASVLRTL"
XX
SQ   Sequence 1230 BP; 253 A; 366 C; 371 G; 239 T; 1 other;
     ctcatgggaa tgcaagcagc cattgagcaa gccatgaaga gccatgagat tctgagcatc        60
     tcagaccctc agacgctggc ccacgtgctg acggctggag tgcagagttc cttgaacgac       120
     cctcgtctcc tcatctccta tgagcccagt gccctggagg ctccgcagca agcaccagca       180
     cacgccaacc tcagccgaga agaactgctg gcacagatgc agagcaacat ccgccacgag       240
     gttcttgaga gcaacgtggg ttacctacga gtggatgacc tcccaggcca agaggtactg       300
     agccagctgg gggagttctt ggtgacccat atatggaagc agctcatggc tacctcgtct       360
     ttggtgctag atctccggca ctgtacaggt ggtcatgtct ctgggatccc ttacgtcatc       420
     tcctacttgt accctgggaa caccgtcatg cacgtggata ccatctatga ccgcccctcc       480
     aataccacca ctgagatctg gaccttgccc aaggtcctag gggagagata cagtgccgac       540
     aaggatgtgg ttgtcctgac cagtggacac actgggggag tggccgagga cattgcntac       600
     atcctcaagc agatgcgcag ggccattgtg gtgggtgagc ggacagaggg tggtgccctg       660
     gacctccaga agttgaggat aggccaatct gacttcttcc tcacagtgcc cgtgtccagg       720
     tccctgggac ccctgggcgg aggtggccag acatgggaag gcagtggagt gctgccctgc       780
     gtggggacac ctgcagagca ggccctggaa aaggccctgg ccatcctcac cctgcgtcgt       840
     gccctgccgg gggttgtcct tcgacttcag gaagccctgc aggactatta cacgctggtg       900
     gaccgagtgc caggcctgct gcaccacctg gctagcatgg actactcagc cgtggtctcc       960
     gaagaggacc tggtggcaaa gctcaatgct ggcttgcagg ctgtgtcgga ggaccccagg      1020
     ctcctggtga gagccaccgg acccagagaa acctcctcaa ggccggagac tgggcctcac      1080
     gattccccag acgccacccc tgaggtgccc acggaagaag ctgcacggag ggccctagtg      1140
     ggctctgtgt ttcaggtctc cgtgctgcca ggcaatgtgg gctacctgcg ctttgacaga      1200
     tttgcagatg cctctgtgct gaggaccctg                                       1230
//


spacer
spacer