Dbfetch

ID   AM910938; SV 1; linear; genomic DNA; STD; ROD; 1230 BP.
XX
AC   AM910938;
XX
DT   21-JUL-2008 (Rel. 96, Created)
DT   21-JUL-2008 (Rel. 96, Last updated, Version 1)
XX
DE   Conilurus penicillatus partial irbp gene for interphotoreceptor retinoid
DE   binding protein
XX
KW   .
XX
OS   Conilurus penicillatus (brush-tailed rabbit-rat)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Conilurus.
XX
RN   [1]
RP   1-1230
RA   Chevret P.;
RT   ;
RL   Submitted (23-NOV-2007) to the INSDC.
RL   Chevret P., Equipe Zoologie Moleculaire/IGFL, ENS de Lyon, 46 Allee
RL   d'Italie, 69364 Lyon cedex 07, FRANCE.
XX
RN   [2]
RX   DOI; 10.1186/1471-2148-8-199.
RX   PUBMED; 18616808.
RA   Lecompte E., Aplin K., Denys C., Catzeflis F., Chades M., Chevret P.;
RT   "Phylogeny and biogeography of African Murinae based on mitochondrial and
RT   nuclear gene sequences, with a new tribal classification of the subfamily";
RL   BMC Evol. Biol. 8(1):199-199(2008).
XX
DR   MD5; 71c78233962693bda4618561191a735d.
DR   EuropePMC; PMC2490707; 18616808.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1230
FT                   /organism="Conilurus penicillatus"
FT                   /mol_type="genomic DNA"
FT                   /country="Australia:Western Australia"
FT                   /collected_by="Watts Ch."
FT                   /tissue_lib="T-527"
FT                   /db_xref="taxon:10127"
FT   CDS             <1..>1230
FT                   /codon_start=1
FT                   /gene="irbp"
FT                   /product="interphotoreceptor retinoid binding protein"
FT                   /db_xref="GOA:B4ERN0"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR032956"
FT                   /db_xref="UniProtKB/TrEMBL:B4ERN0"
FT                   /protein_id="CAP45605.1"
FT                   /translation="LMGMQAAIEQAMKSHEILDISDPQTLAHVLTAGVQSSLNDPRLFI
FT                   SYEPSTLEAPPQAPALTNLTREELLAQIQRNIHHEVLEDNVGYLRLDDLPGQEVLSELG
FT                   EFLVSHVWKXLMSTSSLVLDLRHCTGGQVSGIPYVISYLHPGNTVMHVDTIYDRPSNTT
FT                   TEIWTLPKVLGERYSADKDVVVLTSGHTGGVAEDVAYILKQMRRAIVVGERTEGGALDL
FT                   QKLRIGQSNFFLTVPVSRSLGPLGGGGQTWEGSGVLPCVGTPAEQALEKALAILTXRRA
FT                   LPGVVLRLQQALQDYYTLVDRVPGLLHHLANMDYSAVVSEEDLVTKLNAGLQAVSEDPR
FT                   LLVRATGPRETSSRPETGPNDPPAATPEVPKEEDARRALVDSVFQVSVLPGNVGYLRFD
FT                   EFADASVLRTL"
XX
SQ   Sequence 1230 BP; 274 A; 353 C; 349 G; 252 T; 2 other;
     ctgatgggaa tgcaagcagc cattgagcag gctatgaaga gtcatgagat tctggacatc        60
     tcagaccctc agacgctggc ccatgtgctg acagctggag ttcagagttc cttgaatgac       120
     ccacgtcttt tcatctccta tgagcccagt accctcgagg ctcccccaca agcaccagca       180
     ctcaccaacc tcacccgaga agaactgctg gcccagatac agaggaacat ccaccatgag       240
     gttcttgagg acaacgtggg ctacctacga ttggatgacc tccctggcca ggaggtactg       300
     agtgagctgg gggagttctt agtgagccat gtgtggaagc anctcatgag cacctcctcc       360
     ttggtgctag atctccggca ctgtactggt ggccaagtct ctgggatccc ttatgtcatt       420
     tcctacttgc accctggaaa cactgtcatg cacgtggata caatctatga tcgtccctcc       480
     aacaccacca cagagatctg gaccttgccc aaggtcctag gagagagata cagtgctgac       540
     aaggatgtgg tggtcctcac cagtggacat actgggggag tggccgagga cgttgcctac       600
     atcctcaagc agatgcgcag agccatcgtg gtgggtgagc ggacggaggg tggcgccctg       660
     gacctccaga agctgagaat aggccaatcc aacttcttcc tcacagtgcc tgtgtctagg       720
     tctctgggac ccctaggtgg aggtggccag acatgggaag gcagtggagt gctgccctgc       780
     gtagggacac ctgcagagca agccctagaa aaggccctgg ccatcctcac cntgcgtcgt       840
     gccctgccag gggttgtcct ccgacttcag caagcccttc aggactatta cacattagtg       900
     gaccgagtgc caggcctgct gcaccacctg gctaacatgg actactcagc cgtggtctct       960
     gaagaggacc tggtgacaaa gctcaatgct ggcttgcagg ctgtgtcgga ggaccccaga      1020
     ctcctggtga gagccactgg acccagagaa acctcctcaa gacctgagac tgggcctaat      1080
     gaccccccag cagccacacc tgaggtgccc aaggaagaag atgcccggag ggccctagtg      1140
     gactctgtgt ttcaggtgtc tgtgctgcca ggcaacgtgg gctacctgcg ctttgacgaa      1200
     tttgcagatg cctctgtgct gaggacgctg                                       1230
//