spacer

EBI Dbfetch

ID   AM910937; SV 1; linear; genomic DNA; STD; ROD; 1230 BP.
XX
AC   AM910937;
XX
DT   21-JUL-2008 (Rel. 96, Created)
DT   21-JUL-2008 (Rel. 96, Last updated, Version 1)
XX
DE   Bunomys chrysocomus mitochondrial partial irbp gene for interphotoreceptor
DE   retinoid binding protein
XX
KW   .
XX
OS   Bunomys chrysocomus (Common Bunomys)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Bunomys.
XX
RN   [1]
RP   1-1230
RA   Chevret P.;
RT   ;
RL   Submitted (23-NOV-2007) to the INSDC.
RL   Chevret P., Equipe Zoologie Moleculaire/IGFL, ENS de Lyon, 46 Allee
RL   d'Italie, 69364 Lyon cedex 07, FRANCE.
XX
RN   [2]
RX   DOI; 10.1186/1471-2148-8-199.
RX   PUBMED; 18616808.
RA   Lecompte E., Aplin K., Denys C., Catzeflis F., Chades M., Chevret P.;
RT   "Phylogeny and biogeography of African Murinae based on mitochondrial and
RT   nuclear gene sequences, with a new tribal classification of the subfamily";
RL   BMC Evol. Biol. 8(1):199-199(2008).
XX
DR   MD5; d1b799e2ff8157b4f869aadc82d566fc.
DR   EuropePMC; PMC2490707; 18616808.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1230
FT                   /organism="Bunomys chrysocomus"
FT                   /mol_type="genomic DNA"
FT                   /country="Indonesia:Kamarora Sulawesi"
FT                   /collected_by="Manuel Ruedi"
FT                   /tissue_lib="T-1288"
FT                   /db_xref="taxon:485423"
FT   CDS             <1..>1230
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /gene="irbp"
FT                   /product="interphotoreceptor retinoid binding protein"
FT                   /db_xref="GOA:B4ERM9"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:B4ERM9"
FT                   /protein_id="CAP45604.1"
FT                   /translation="LMGMQAAIEQAMKSHEILGISDPQTLAHVLTVGVQSSLNDPRLFI
FT                   SYEPSTLEAPQQAPALTDLTREELLAQIQRNIRHEVLEGNVGYLRVDDLPGQEVLSELG
FT                   EFLVSHVWKQLMGTSSLVLDLRHCAGGHVSGIPYVISYLHPGNTVLHVDTIYDRPSNTT
FT                   TEIWTLPKVLGERYSADKDVVVLTSGHTGGVAEDIAYILKQMRRAIVVGERTEGGALDL
FT                   QKLRIGQSDFFLTVPVSRSLGPLGGGGQTWEGSGVLPCVGIPAEQALEKALAILTLRRA
FT                   LPGVVLRLQEALQDYYTLVDRVPGLLHHLASMDYSTVVSEEDLVTKLNAGLQAVSEDPR
FT                   LLVRATGPRETPSRPETGPNDPPAVTPEVPKEEAARRALVDSVFQVSVLPGNVGYLRFD
FT                   RFADASVLKTL"
XX
SQ   Sequence 1230 BP; 256 A; 356 C; 369 G; 248 T; 1 other;
     ctgatgggaa tgcaagcagc cattgagcag gctatgaaga gtcatgagat tctaggcatc        60
     tcggaccctc agacgctggc ccatgtgctg acagttggag tncagagctc tttgaatgac       120
     ccacgtctct tcatctccta tgagcccagt accctcgagg ctccccagca agcaccagcg       180
     ctcaccgacc tcacccgaga agaactgctg gcccagatac agaggaacat ccgccatgag       240
     gttcttgagg gtaacgtggg ctacctacga gtggatgacc tccctggaca ggaggtactg       300
     agtgagctgg gggagttcct agtgagccat gtgtggaagc agctcatggg cacctcctcc       360
     ttggtgttag atctccgtca ctgtgctggt ggccatgtct ctgggatccc ttatgtcatc       420
     tcctacttgc accctgggaa cacagtcttg cacgtggata ccatctacga tcggccctct       480
     aacaccacca cagagatctg gaccttgcct aaggtcctgg gggagagata cagtgctgac       540
     aaggatgtgg tggtcctcac cagtggacat actgggggag tagctgagga catcgcttac       600
     atcctcaagc agatgcgcag ggccatcgtg gtgggtgagc ggacggaggg tggcgccctg       660
     gacctccaga agctgagaat aggccagtct gacttcttcc ttacggtgcc tgtgtccagg       720
     tccctggggc cccttggtgg aggcggccaa acgtgggaag gcagcggggt gctgccctgt       780
     gtggggatac ctgcagagca agccctagaa aaggccttgg ccatcctcac cctgcgtcgt       840
     gccctgccag gcgttgtcct ccgactccag gaagccctac aggactatta cacattagtg       900
     gaccgagtgc cgggcctgct gcaccacctg gccagcatgg actactcgac cgtggtctcc       960
     gaagaggacc tggtgacaaa gctcaatgct ggtttgcagg ctgtgtcgga ggatcccagg      1020
     ctcctggtga gagccaccgg acccagagaa accccctcaa gacctgagac tggacctaac      1080
     gacccaccag cagtcacccc tgaggtgccc aaggaagaag ctgcccggag ggccctagtg      1140
     gactcggtgt ttcaggtgtc cgtgctgccg ggcaatgtgg gctacctgcg ctttgacaga      1200
     tttgcagacg cctccgtgct gaagacactg                                       1230
//


spacer
spacer