spacer

EBI Dbfetch

ID   AM910936; SV 1; linear; genomic DNA; STD; ROD; 744 BP.
XX
AC   AM910936;
XX
DT   21-JUL-2008 (Rel. 96, Created)
DT   21-JUL-2008 (Rel. 96, Last updated, Version 1)
XX
DE   Pseudomys australis mitochondrial partial cytb gene for cytochrome b
XX
KW   .
XX
OS   Pseudomys australis (plains mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Pseudomys.
OG   Mitochondrion
XX
RN   [1]
RP   1-744
RA   Chevret P.;
RT   ;
RL   Submitted (23-NOV-2007) to the INSDC.
RL   Chevret P., Equipe Zoologie Moleculaire/IGFL, ENS de Lyon, 46 Allee
RL   d'Italie, 69364 Lyon cedex 07, FRANCE.
XX
RN   [2]
RX   DOI; 10.1186/1471-2148-8-199.
RX   PUBMED; 18616808.
RA   Lecompte E., Aplin K., Denys C., Catzeflis F., Chades M., Chevret P.;
RT   "Phylogeny and biogeography of African Murinae based on mitochondrial and
RT   nuclear gene sequences, with a new tribal classification of the subfamily";
RL   BMC Evol. Biol. 8(1):199-199(2008).
XX
DR   MD5; 4358d64b0c4aaa2350e94441c368bd7c.
DR   EuropePMC; PMC2490707; 18616808.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..744
FT                   /organism="Pseudomys australis"
FT                   /organelle="mitochondrion"
FT                   /mol_type="genomic DNA"
FT                   /country="Australia"
FT                   /collected_by="Watts Ch."
FT                   /tissue_lib="T-526"
FT                   /db_xref="taxon:187268"
FT   CDS             1..>744
FT                   /transl_table=2
FT                   /gene="cytb"
FT                   /product="cytochrome b"
FT                   /db_xref="GOA:B4ERM8"
FT                   /db_xref="InterPro:IPR005797"
FT                   /db_xref="InterPro:IPR005798"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="InterPro:IPR023530"
FT                   /db_xref="InterPro:IPR027387"
FT                   /db_xref="UniProtKB/TrEMBL:B4ERM8"
FT                   /protein_id="CAP45603.1"
FT                   /translation="MTNMRKTHPLMKMINHSFIDLPAPSNISSWWNFGSLLGLCLMIQI
FT                   ITGLFLAMHYTSDTMTAFSSVTHICRDVNYGWLIRYMHANGASMFFICLFLHVGRGIYY
FT                   GSYTFIETWNIGVLLLFAVMATAFMGYVLPWGQMSFWGATVITNLLSAIPYIGTTLVEW
FT                   IWGGFSVDKATLTRFFAFHFILPFIITALVIVHLLFLHETGSNNPTGLNSDADKIPFHP
FT                   YYTVKDLLGMLILILFFMTLVLFFPD"
XX
SQ   Sequence 744 BP; 236 A; 194 C; 97 G; 217 T; 0 other;
     atgacaaaca tacgaaaaac acatcccttg ataaaaataa ttaaccactc tttcattgac        60
     ctaccagccc catccaatat ctcatcatga tgaaacttcg gctctctctt aggactatgc       120
     ctaataattc aaatcatcac aggactattt ctagccatac actatacatc agatacaata       180
     acagcattct catcagtcac ccacatctgc cgagacgtaa actacggctg actaatccga       240
     tatatgcacg caaatggagc ctcaatattc tttatttgct tgttcttaca tgttggacga       300
     ggaatttact atggatccta taccttcatt gaaacatgaa acattggagt tctactatta       360
     tttgcagtta tagccactgc atttataggc tatgtcctcc catgaggtca aatatcattc       420
     tgaggagcaa ccgttattac caacctacta tcagccattc catacatcgg aactacacta       480
     gtagagtgaa tctgaggagg attttcagta gacaaagcca ccttaacacg attcttcgct       540
     ttccatttca tcctaccatt catcattaca gccctagtaa tcgtccatct tctattcctc       600
     cacgaaactg gatctaataa ccccacagga ctaaactcag acgcggacaa aattccattc       660
     cacccatact acacagtaaa agacctacta ggcatactaa tcttaatcct atttttcata       720
     actctagtgt tattcttccc agat                                              744
//


spacer
spacer