spacer

EBI Dbfetch

ID   AM910935; SV 1; linear; genomic DNA; STD; ROD; 1140 BP.
XX
AC   AM910935;
XX
DT   21-JUL-2008 (Rel. 96, Created)
DT   21-JUL-2008 (Rel. 96, Last updated, Version 1)
XX
DE   Conilurus penicillatus mitochondrial partial cytb gene for cytochrome b
XX
KW   .
XX
OS   Conilurus penicillatus (brush-tailed rabbit-rat)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Conilurus.
OG   Mitochondrion
XX
RN   [1]
RP   1-1140
RA   Chevret P.;
RT   ;
RL   Submitted (23-NOV-2007) to the INSDC.
RL   Chevret P., Equipe Zoologie Moleculaire/IGFL, ENS de Lyon, 46 Allee
RL   d'Italie, 69364 Lyon cedex 07, FRANCE.
XX
RN   [2]
RX   DOI; 10.1186/1471-2148-8-199.
RX   PUBMED; 18616808.
RA   Lecompte E., Aplin K., Denys C., Catzeflis F., Chades M., Chevret P.;
RT   "Phylogeny and biogeography of African Murinae based on mitochondrial and
RT   nuclear gene sequences, with a new tribal classification of the subfamily";
RL   BMC Evol. Biol. 8(1):199-199(2008).
XX
DR   MD5; 1bb516fe391840f2f559c0661345f202.
DR   EuropePMC; PMC2490707; 18616808.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1140
FT                   /organism="Conilurus penicillatus"
FT                   /organelle="mitochondrion"
FT                   /mol_type="genomic DNA"
FT                   /country="Australia:Western Australia"
FT                   /collected_by="Watts Ch."
FT                   /tissue_lib="T-527"
FT                   /db_xref="taxon:10127"
FT   CDS             1..>1140
FT                   /transl_table=2
FT                   /gene="cytb"
FT                   /product="cytochrome b"
FT                   /db_xref="GOA:B4ERM7"
FT                   /db_xref="InterPro:IPR005797"
FT                   /db_xref="InterPro:IPR005798"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="InterPro:IPR027387"
FT                   /db_xref="UniProtKB/TrEMBL:B4ERM7"
FT                   /protein_id="CAP45602.1"
FT                   /translation="MTNMRKTHPLMKIINNSFIDLPAPSNISSWWNFGSLLGLCLTIQI
FT                   ITGLFLAMHYTSDTTTAFSSVTHICRDVNYGWLIRYMHANGASMFFICLFLHIGRGMYY
FT                   GSYTFTETWNIGVILLFTVMATAFMGYVLPWGQMSFWGATVITNLLSAIPYIGTTLVEW
FT                   IWGGFSVDKATLTRFFAFHFILPFIITALVIVHLLFLHETGSNNPTGLNSDADKIPFHP
FT                   YYTVKDLLGVFILMSFFMTLVLFFPDLLGDPDNYTPANPLNTPPHIKPEWYFLFAYAIL
FT                   RSIPNKLGGVLALILSILILAFLPMLHTSKQRSLIFRPITQTLYWILVANLMLLTWIGG
FT                   QPVEYPFIIIGQLASISYFSIILILMPISGMIENKMLKWD"
XX
SQ   Sequence 1140 BP; 367 A; 327 C; 136 G; 309 T; 1 other;
     atgacaaaca tacgaaaaac ccaccctcta ataaaaatta tcaacaactc tttcatcgac        60
     ctaccagccc catccaacat ttcatcatga tgaaactttg gctcccttct aggactatgc       120
     ctcacaatcc aaatcatcac agggttgttt ctagctatac actatacatc agacacaaca       180
     accgcatttt catcagtcac acacatttgc cgagatgtta actacggatg actaatccga       240
     tatatacacg caaacggagc ttctatattc ttcatttgct tattcctaca tatcggacga       300
     ggcatatatt acggatccta cacctttaca gaaacatgaa acattggagt aatcttacta       360
     ttcactgtca tagccaccgc attcataggc tatgtgcttc catgaggaca aatatcattc       420
     tgaggagcaa cagtcatcac aaacctccta tcagctattc catatattgg caccacacta       480
     gtcgaatgaa tctgaggtgg gttttcagta gacaaagcca ccctaacacg atttttcgcc       540
     ttccacttta tccttccatt tatcatcaca gccctagtaa tcgtccacct cctattcctg       600
     cacgaaacag gttccaacaa cccaacaggc ctaaattcag acgcagacaa aatcccattc       660
     cacccatact atacagtaaa agaccttcta ggcgtgttta tcctaatatc atttttcata       720
     accctagtcc tattttttcc agacctccta ggagacccag acaactatac acctgcaaat       780
     ccacttaaca caccacccca tatcaaacca gaatgatatt tcctatttgc ctatgccatc       840
     ctacgctcaa ttcctaacaa actaggcgga gtattagccc taatcttatc catcctaatt       900
     ctagcattcc taccaatact ccacacatca aaacaacgca gcctgatttt ccgcccaatc       960
     acccaaaccc tttactgaat cctagtagca aacctnatac tcctaacctg aattggagga      1020
     caacccgtcg aatacccatt catcatcatc ggacaattag cttccatcag ctatttctct      1080
     attatcctaa ttttaatacc aatctcagga ataattgaaa acaaaatact aaaatgagac      1140
//


spacer
spacer