spacer

EBI Dbfetch

ID   AM910934; SV 1; linear; genomic DNA; STD; ROD; 744 BP.
XX
AC   AM910934;
XX
DT   21-JUL-2008 (Rel. 96, Created)
DT   21-JUL-2008 (Rel. 96, Last updated, Version 1)
XX
DE   Bunomys chrysocomus mitochondrial partial cytb gene for cytochrome b
XX
KW   .
XX
OS   Bunomys chrysocomus (Common Bunomys)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Bunomys.
OG   Mitochondrion
XX
RN   [1]
RP   1-744
RA   Chevret P.;
RT   ;
RL   Submitted (23-NOV-2007) to the INSDC.
RL   Chevret P., Equipe Zoologie Moleculaire/IGFL, ENS de Lyon, 46 Allee
RL   d'Italie, 69364 Lyon cedex 07, FRANCE.
XX
RN   [2]
RX   DOI; 10.1186/1471-2148-8-199.
RX   PUBMED; 18616808.
RA   Lecompte E., Aplin K., Denys C., Catzeflis F., Chades M., Chevret P.;
RT   "Phylogeny and biogeography of African Murinae based on mitochondrial and
RT   nuclear gene sequences, with a new tribal classification of the subfamily";
RL   BMC Evol. Biol. 8(1):199-199(2008).
XX
DR   MD5; fcd41e152f81de7ab62b1e3649fee382.
DR   EuropePMC; PMC2490707; 18616808.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..744
FT                   /organism="Bunomys chrysocomus"
FT                   /organelle="mitochondrion"
FT                   /mol_type="genomic DNA"
FT                   /country="Indonesia:Kamarora Sulawesi"
FT                   /collected_by="Manuel Ruedi"
FT                   /tissue_lib="T-1288"
FT                   /db_xref="taxon:485423"
FT   CDS             1..>744
FT                   /transl_table=2
FT                   /gene="cytb"
FT                   /product="cytochrome b"
FT                   /db_xref="GOA:B4ERM6"
FT                   /db_xref="InterPro:IPR005797"
FT                   /db_xref="InterPro:IPR005798"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="InterPro:IPR023530"
FT                   /db_xref="InterPro:IPR027387"
FT                   /db_xref="UniProtKB/TrEMBL:B4ERM6"
FT                   /protein_id="CAP45601.1"
FT                   /translation="MTNIRKSHPLLKIINHSFIDLPAPSNISSWWNFGSLLGVCLMLQI
FT                   VTGLFLAMHYTSDTTTAFSSVTHICRDVNYGWLIRYLHANGASMFFICLFLHVGRGMYY
FT                   GSYTFLETWNIGVVLLFAVMATAFMGYVLPWGQMSFWGATVITNLLSAIPYIGTTLVEW
FT                   IWGGFSVDKATLTRFFAFHFILPFIIAALAIVHLLFLHETGSNNPTGINSDADKIPFHP
FT                   YYTIKDLLGVFILLLLLMILVLFFPD"
XX
SQ   Sequence 744 BP; 214 A; 222 C; 105 G; 203 T; 0 other;
     atgacaaaca ttcgaaaatc tcacccccta ctcaaaatta tcaaccactc cttcatcgac        60
     ctacccgccc catccaacat ctcatcatga tgaaattttg gctctctcct aggagtatgt       120
     ctcatacttc aaatcgtcac aggcctgttc ctagcaatac actacacatc cgatactaca       180
     acagcattct catccgtcac tcatatttgc cgagacgtaa actacggctg actgatccga       240
     tacctacatg ccaacggagc ctcaatattt ttcatctgct tatttcttca tgtaggacga       300
     ggcatatact atgggtccta taccttccta gaaacatgaa acattggagt cgtcctatta       360
     tttgcagtta tggcaaccgc attcataggc tatgtgctcc catgaggaca aatgtccttc       420
     tgaggcgcca cagtaattac aaaccttcta tcagcaatcc cttacatcgg aacaacccta       480
     gtcgaatgga tctgaggggg cttctcagta gacaaagcaa ctctaacacg atttttcgca       540
     ttccacttca tccttccatt catcatcgcc gcccttgcaa tcgtacacct actatttctc       600
     cacgagacag gctcaaacaa ccctacagga atcaactcag acgcagacaa aatccccttt       660
     cacccctatt acacaattaa agacctccta ggagtgttta tcctactcct attactaata       720
     atcctagtac tattcttccc agac                                              744
//


spacer
spacer