spacer

EBI Dbfetch

ID   AM900846; SV 2; linear; genomic DNA; STD; ROD; 1146 BP.
XX
AC   AM900846;
XX
DT   20-DEC-2007 (Rel. 94, Created)
DT   20-DEC-2007 (Rel. 94, Last updated, Version 1)
XX
DE   Oryzomys macconnelli partial ncoa1 gene for nuclear receptor coactivator 1,
DE   tissue library T-4973
XX
KW   ncoa1 gene; nuclear receptor coactivator 1.
XX
OS   Euryoryzomys macconnelli (MacConnell's rice rat)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Cricetidae; Sigmodontinae; Euryoryzomys.
XX
RN   [1]
RP   1-1146
RA   Tilak M.K.;
RT   ;
RL   Submitted (15-OCT-2007) to the INSDC.
RL   Tilak M.K., Institut des Sciences de l'Evolution, Universite Montpellier
RL   II, Place E Bataillon, 34095, FRANCE.
XX
RN   [2]
RX   DOI; 10.1186/1471-2148-7-241.
RX   PUBMED; 18053139.
RA   Ranwez V., Delsuc F., Ranwez S., Belkir K., Tilak M.K., Douzery E.J.;
RT   "OrthoMaM: a database of orthologous genomic markers for placental mammal
RT   phylogenetics";
RL   BMC Evol. Biol. 7(1):241-241(2007).
XX
DR   MD5; 7866dee80fc64d92849f6e28277a5d37.
DR   EuropePMC; PMC2249597; 18053139.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1146
FT                   /organism="Euryoryzomys macconnelli"
FT                   /mol_type="genomic DNA"
FT                   /tissue_lib="T-4973"
FT                   /tissue_type="Viscerae"
FT                   /db_xref="taxon:48006"
FT   CDS             <1..>1137
FT                   /codon_start=2
FT                   /gene="ncoa1"
FT                   /product="nuclear receptor coactivator 1"
FT                   /db_xref="GOA:A9HTL2"
FT                   /db_xref="InterPro:IPR008955"
FT                   /db_xref="InterPro:IPR014935"
FT                   /db_xref="InterPro:IPR017426"
FT                   /db_xref="InterPro:IPR028819"
FT                   /db_xref="UniProtKB/TrEMBL:A9HTL2"
FT                   /protein_id="CAP15783.2"
FT                   /translation="IPRMNPSVNPGISPAHGVSRSSTLPPSNNNMVSARVNRQQSSDLN
FT                   CGSSHSNSSNNQGSFGCSPGNQIVANVALNQGQAGSQSSNPSLNLSNSPMENTGISLTQ
FT                   FMSPRRQANSGLSARARMPNNSFSPNIPTLSSPVGITSGACNNNNRSYSNIPVTSLQGM
FT                   NEGPNNSVGFSASSPGLRQMNSQNSPSRLSMQPAKAESRDNKEIASILNEMIQSDNSAN
FT                   DSKPLDSGLLHNNDRLSDGDSKYSQTSHKLVQLLTTSAEQQLRHADIDTSCKDALTCTG
FT                   TSSSASANPSGGTCPSYHSSLTERHKILHRLLQEGSPSDITTLSVEPEKKDSTSASTPV
FT                   SMPGQAPGNSSVKLELDASKKKETKDHQLLRYLLDKDE"
XX
SQ   Sequence 1146 BP; 347 A; 292 C; 232 G; 273 T; 2 other;
     aattccccga atgaaccctt cagtcaatcc tggtatctct ccagcccatg gcgtgagccg        60
     ttcttctaca ttgccaccat ccaataataa catggtctct gccagagtaa accgccaaca       120
     gagctcagac ctaaattgcg gtagcagtca tagtaattct agcaacaacc aggggagttt       180
     tggatgctca cctggaaatc agattgtagc caatgttgcc ttaaaccagg gacaggcagg       240
     ttcccagagc agtaatcctt ctttgaacct cagcaactct cctatggaaa atacaggaat       300
     ttccctcacg cagttcatgt ctccgaggag acaggctaat tctggcttgt cagcaagggc       360
     caggatgcct aacaattcat tttctccaaa tattccaaca ttaagctccc cagttggcat       420
     tactagtggt gcctgtaata ataataaccg atcttattca aatatcccgg taacatcttt       480
     acaaggtatg aatgaaggac ccaataactc tgttggcttc tctgccagtt ctccaggcct       540
     taggcagatg aactcacaga attcgcctag cagattaagt atgcaaccag caaaagcaga       600
     gtccagagat aataaagaga ttgcatctat tttaaatgaa atgatccaat ctgacaacag       660
     tgctaatgat agcaaacctc tggattcggg acttctgcat aacaatgaca gactctcgga       720
     tggagacagt aaatactctc agactagtca caaactagtc cagctgttga caacatccgc       780
     agaacagcag ctacgacatg ctgatataga caccagctgc aaggatgcac tgacwtgtac       840
     aggcacttcc agctctgcct ccgctaaccc ttcaggaggt acttgcccct cttaccacag       900
     ttctctgact gagcggcata aaattctgca ccggctttta cargagggta gcccctcaga       960
     catcaccact ttgtctgtgg aacctgagaa aaaggacagt acatcagctt ctactcctgt      1020
     gtcgatgcct ggacaagctc cggggaacag cagtgtaaaa ctagaactgg atgcctcaaa      1080
     gaaaaaagag acaaaagacc atcagctcct gcgctacctt ttagacaaag atgagaagga      1140
     tttaag                                                                 1146
//


spacer
spacer