spacer

EBI Dbfetch

ID   AM900835; SV 1; linear; genomic DNA; STD; ROD; 1049 BP.
XX
AC   AM900835;
XX
DT   20-DEC-2007 (Rel. 94, Created)
DT   20-DEC-2007 (Rel. 94, Last updated, Version 1)
XX
DE   Jaculus jaculus partial chgut gene for chondroitin sulfate
DE   glucuronyltransferase, tissue library T-0552
XX
KW   chgut gene; chondroitin sulfate glucuronyltransferase.
XX
OS   Jaculus jaculus (lesser Egyptian jerboa)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Dipodidae;
OC   Dipodinae; Jaculus.
XX
RN   [1]
RP   1-1049
RA   Tilak M.K.;
RT   ;
RL   Submitted (15-OCT-2007) to the INSDC.
RL   Tilak M.K., Institut des Sciences de l'Evolution, Universite Montpellier
RL   II, Place E Bataillon, 34095, FRANCE.
XX
RN   [2]
RX   DOI; 10.1186/1471-2148-7-241.
RX   PUBMED; 18053139.
RA   Ranwez V., Delsuc F., Ranwez S., Belkir K., Tilak M.K., Douzery E.J.;
RT   "OrthoMaM: a database of orthologous genomic markers for placental mammal
RT   phylogenetics";
RL   BMC Evol. Biol. 7(1):241-241(2007).
XX
DR   MD5; dd99ffeedf68bdb16df2f22faa1072fc.
DR   EuropePMC; PMC2249597; 18053139.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1049
FT                   /organism="Jaculus jaculus"
FT                   /mol_type="genomic DNA"
FT                   /tissue_lib="T-0552"
FT                   /tissue_type="Viscerae"
FT                   /db_xref="taxon:51337"
FT   CDS             <1..>1049
FT                   /codon_start=1
FT                   /gene="chgut"
FT                   /product="chondroitin sulfate glucuronyltransferase"
FT                   /db_xref="GOA:A9HTB8"
FT                   /db_xref="InterPro:IPR008428"
FT                   /db_xref="UniProtKB/TrEMBL:A9HTB8"
FT                   /protein_id="CAP15772.1"
FT                   /translation="KAGLSWPIGLPAPFTPRSRFEVLGWDYFTEQHAFSCADGAPKCPL
FT                   QGASRADVGDAVDTALEQLNRRYQPRLRFQKQRLLNGYRRFDPARGMEYTLDLLLEAVT
FT                   QRGHRRALARRVSLLRPLSRVEILPMPYVTEATRVQLVLPLLVAEAAAALAFLEAFATS
FT                   ALEPRENALLTLLLVYGPREGGRGAPDPFLRVKAAAAELERRYPGARLAWLAVRAEAPS
FT                   QVRLMDVISKKHPVDTLFFLTTVWTRPGPEVLNRCRMNAISGWQAFFPVHFQEFNPILS
FT                   PQRSPPGPPGAGPDPPSPPGADPSHGTPVGGRFDRQASAEGCFYNADYLAARARLAGEL
FT                   AGQEEEEAL"
XX
SQ   Sequence 1049 BP; 173 A; 346 C; 327 G; 202 T; 1 other;
     aaggcaggcc tgagctggcc cattgggctc ccagcccctt tcacaccacg ctctcgcttt        60
     gaggtactgg gctgggacta cttcacggag cagcacgcct tctcctgtgc cgatggggct       120
     cccaagtgcc cgctgcaggg ggcgagcagg gcagacgtgg gcgatgctgt ggacactgct       180
     ctggagcagc tcaatcgccg ctaccagccc cgtctacgct tccagaagca gcgcttgctc       240
     aatggctacc ggcgttttga cccagctcgg ggcatggagt acaccctgga cctgcttttg       300
     gaagctgtga ctcagcgcgg gcaccggagg gccctggccc gcagggtcag cctgctgcgg       360
     ccactgagcc gggtggaaat tctgccgatg ccttatgtaa ccgaggccac ccgggtgcag       420
     ctggtactgc cgctccttgt ggccgaagcg gctgcagccc tggctttcct cgaggccttt       480
     gccaccagtg ccctggagcc ccgagagaac gcgctgctca ccctgttgct ggtctatggg       540
     ccccgggaag gcggccgtgg ggctcccgat ccatttctca gggtgaaggc tgcagcggct       600
     gagctagaac gacggtaccc cggggcaagg ctggcctggc ttgccgtgcg agcggaggcc       660
     ccttcccagg tgcgactaat ggatgtgatc tccaagaagc accctgtgga cacgcttttc       720
     ttcctcacca ctgtgtggac taggcctggt cctgaagtcc tcaaccgctg ccgcatgaat       780
     gccatatctg gctggcaggc cttttttcca gtgcacttcc aggagttcaa ccccatccta       840
     tcaccacaga gatcrccccc aggaccccca ggggctggcc ctgatccccc atcccctcct       900
     ggcgcggacc cttcccatgg gactccggtt gggggcagat ttgaccggca ggcatctgca       960
     gagggctgtt tctacaacgc tgactacctg gcagcccgtg cccggctggc tggtgaactg      1020
     gcaggccagg aagaggagga agccctgga                                        1049
//


spacer
spacer