Dbfetch

ID   AM900764; SV 1; linear; genomic DNA; STD; HUM; 634 BP.
XX
AC   AM900764;
XX
DT   16-OCT-2007 (Rel. 93, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 2)
XX
DE   Homo sapiens partial HLA-DQB1 gene for MHC class II antigen, HLA-DQB1*06new
DE   allele, exons 2-3, isolate 72330002
XX
KW   HLA-DQB1 gene; MHC class II antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-634
RA   Schwab S.;
RT   ;
RL   Submitted (15-OCT-2007) to the INSDC.
RL   Schwab S., Immunogenetics, Laboratory for Medical Genetics, Lochhamer Str.
RL   29, 82152 Martinsried, GERMANY.
XX
RN   [2]
RA   Schwab S., Woelpl A., Klein H.;
RT   "A new HLA-DQB1 allel found in a German bone marrow donor.";
RL   Unpublished.
XX
DR   MD5; 84df35c6b907dbeef0e77978c5cbc4a5.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..634
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /isolate="72330002"
FT                   /mol_type="genomic DNA"
FT                   /dev_stage="adult"
FT                   /cell_type="leukocyte"
FT                   /tissue_type="peripheral blood"
FT                   /db_xref="taxon:9606"
FT   CDS             join(<1..261,362..>634)
FT                   /codon_start=3
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*06new"
FT                   /product="MHC class II antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:A8KS05"
FT                   /db_xref="IMGT/HLA:DQB1*06:02:02"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:A8KS05"
FT                   /protein_id="CAP12879.1"
FT                   /translation="FQFKGMCYFTNGTERVRLVTRYIYNREEYARFDSDVGVYRAVTPQ
FT                   GRPDAEYWNSQKEVLEGTRAELDTVCRHNYEVAFRGILQRRAVTISPSRTEALNHHNLL
FT                   VCSVTDFYPGQIKVRWFRNDQEETAGVVSTPLIRNGDWTFQILVMLEMTPQRGDVYTCH
FT                   VEHPSLQSPITVEW"
FT   exon            <1..261
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*06new"
FT                   /number=2
FT   gap             262..361
FT                   /estimated_length=unknown
FT   exon            362..634
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*06new"
FT                   /number=3
XX
SQ   Sequence 634 BP; 117 A; 150 C; 168 G; 99 T; 100 other;
     tgttccagtt taagggcatg tgctacttca ccaacgggac ggagcgcgtg cgtcttgtga        60
     ccagatacat ctataaccga gaggagtacg cacgcttcga cagcgacgtg ggggtgtacc       120
     gcgcggtgac gccgcagggg cggcctgatg ccgagtactg gaacagccag aaggaagtcc       180
     tggaggggac ccgggcggag ttggacacgg tgtgcagaca caactacgag gtggcgttcc       240
     gcgggatctt gcagaggaga gnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     ncagtgacca tctccccatc caggacagag gccctcaacc accacaacct gctggtctgc       420
     tcggtgacag atttctatcc aggccagatc aaagtccggt ggtttcggaa tgatcaggag       480
     gagacagccg gcgttgtgtc cacccccctt attaggaatg gtgactggac tttccagatc       540
     ctggtgatgc tggaaatgac tccccagcgt ggagatgtct acacctgcca cgtggagcac       600
     cccagcctcc agagccccat caccgtggag tggc                                   634
//