spacer

EBI Dbfetch

ID   AM899996; SV 1; linear; genomic DNA; STD; HUM; 1257 BP.
XX
AC   AM899996;
XX
DT   09-OCT-2007 (Rel. 93, Created)
DT   13-JAN-2009 (Rel. 99, Last updated, Version 3)
XX
DE   Homo sapiens partial MICA gene for MHC class I chain-related protein A,
DE   MICA*010v allele, exons 2-5
XX
KW   major histocompatibility complex; MHC class I chain-related protein A;
KW   MICA gene; MICA*010v allele.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1257
RA   Cox S.T.;
RT   ;
RL   Submitted (08-OCT-2007) to the INSDC.
RL   Cox S.T., The Royal Free Hospital, Anthony Nolan Research Institute, Pond
RL   Street, Hampstead, London, NW3 2QG, UNITED KINGDOM.
XX
RN   [2]
RX   DOI; 10.1111/j.1399-0039.2008.01173.x.
RX   PUBMED; 19140841.
RA   Cox S.T., Stephens H.A.F., Fernando R., Grant J., Madrigal J.A.,
RA   Little A.-.M.;
RT   "Two novel MICA alleles, MICA*054 and MICA*056";
RL   Tissue Antigens 73(1):85-87(2009).
XX
DR   MD5; 90a183159f41d0b32b0521bd07bf928a.
DR   Ensembl-Gn; ENSG00000183214; homo_sapiens.
DR   Ensembl-Gn; ENSG00000235233; homo_sapiens.
DR   Ensembl-Tr; ENST00000400325; homo_sapiens.
DR   Ensembl-Tr; ENST00000418465; homo_sapiens.
DR   Ensembl-Tr; ENST00000547609; homo_sapiens.
DR   IMGT/LIGM; AM899996.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1257
FT                   /organism="Homo sapiens"
FT                   /chromosome="6p"
FT                   /mol_type="genomic DNA"
FT                   /tissue_type="blood"
FT                   /db_xref="taxon:9606"
FT   CDS             join(<1..255,356..643,744..1022,1123..>1257)
FT                   /codon_start=3
FT                   /gene="MICA"
FT                   /allele="MICA*010v"
FT                   /product="MHC class I chain-related protein A"
FT                   /db_xref="GOA:Q29983"
FT                   /db_xref="HGNC:HGNC:7090"
FT                   /db_xref="IMGT/HLA:MICA*054"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="PDB:1B3J"
FT                   /db_xref="PDB:1HYR"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q29983"
FT                   /protein_id="CAP12057.1"
FT                   /translation="PHSLPYNLTVLSWDGSVQSGFLAEVHLDGQPFLRYDRQKCRAKPQ
FT                   GQWAEDVLGNKTWDRETRDLTGNGKDLRMTLAHIKDQKEGLHSLQEIRVCEIHEDNSTR
FT                   SSQHFYYDGELFLSQNLETEEWTVPQSSRAQTLAMNVRNFLKEDAMKTKTHYHAMHADC
FT                   LQELRRYLESSVVLRRTVPPMVNVTRSEASEGNITVTCRASSFYPRNIILTWRQDGVSL
FT                   SHDTQQWGDVLPDGNGTYQTWVATRICRGEEQRFTCYMEHSGNHGTHPVPSGKVLVLQS
FT                   HWQTFHVSAVAAAAAIFVIIIFYVRCCKKKTSAAEGP"
FT   exon            1..255
FT                   /gene="MICA"
FT                   /allele="MICA*010v"
FT                   /number=2
FT   gap             256..355
FT                   /estimated_length=unknown
FT   exon            356..643
FT                   /gene="MICA"
FT                   /allele="MICA*010v"
FT                   /number=3
FT   gap             644..743
FT                   /estimated_length=unknown
FT   exon            744..1022
FT                   /gene="MICA"
FT                   /allele="MICA*010v"
FT                   /number=4
FT   variation       1001
FT                   /allele="MICA*010v"
FT                   /replace="a"
FT                   /compare=AF085057.1
FT   gap             1023..1122
FT                   /estimated_length=unknown
FT   exon            1123..1257
FT                   /gene="MICA"
FT                   /allele="MICA*010v"
FT                   /number=5
XX
SQ   Sequence 1257 BP; 241 A; 245 C; 267 G; 204 T; 300 other;
     agccccacag tcttccttat aacctcacgg tgctgtcctg ggatggatct gtgcagtcag        60
     ggtttcttgc tgaggtacat ctggatggtc agcccttcct gcgctatgac aggcagaaat       120
     gcagggcaaa gccccaggga cagtgggcag aagatgtcct gggaaataag acatgggaca       180
     gagagaccag ggacttgaca gggaacggaa aggacctcag gatgaccctg gctcatatca       240
     aggaccagaa agaagnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnngcttg       360
     cattccctcc aggagattag ggtctgtgag atccatgaag acaacagcac caggagctcc       420
     cagcatttct actacgatgg ggagctcttc ctctcccaaa acctggagac tgaggaatgg       480
     acagtgcccc agtcctccag agctcagacc ttggccatga acgtcaggaa tttcttgaag       540
     gaagatgcca tgaagaccaa gacacactat cacgctatgc atgcagactg cctgcaggaa       600
     ctacggcgat atctagaatc cagcgtagtc ctgaggagaa cagnnnnnnn nnnnnnnnnn       660
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       720
     nnnnnnnnnn nnnnnnnnnn nnntgccccc catggtgaat gtcacccgca gcgaggcctc       780
     agagggcaac atcaccgtga catgcagggc ttccagcttc tatccccgga atatcatact       840
     gacctggcgt caggatgggg tatctttgag ccacgacacc cagcagtggg gggatgtcct       900
     gcctgatggg aatggaacct accagacctg ggtggccacc aggatttgcc gaggagagga       960
     gcagaggttc acctgctaca tggaacacag cgggaatcac ggcactcacc ctgtgccctc      1020
     tgnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1080
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnggaaagtg ctggtgcttc      1140
     agagtcattg gcagacattc catgtttctg ctgttgctgc tgctgctgct atttttgtta      1200
     ttattatttt ctatgtccgt tgttgtaaga agaaaacatc agctgcagag ggtccag         1257
//


spacer
spacer