spacer

EBI Dbfetch

ID   AM889027; SV 1; linear; genomic DNA; STD; HUM; 792 BP.
XX
AC   AM889027;
XX
DT   05-OCT-2007 (Rel. 93, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 2)
XX
DE   Homo sapiens partial HLA-B gene for MHC class II antigen, HLA-B*57v allele,
DE   exons 2-3
XX
KW   HLA-B gene; HLA-B*57v allele; human leucocyte antigen B;
KW   major histocompatibility complex; MHC class II antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-792
RA   Tiercy J.M.;
RT   ;
RL   Submitted (04-OCT-2007) to the INSDC.
RL   Tiercy J.M., University Hospital Geneva, Transplantation Immunology
RL   Unit/LNRH, 24 Rue Micheli-du-Crest, 1211 Geneva 14, SWITZERLAND.
XX
RN   [2]
RA   Rahal M., Kervaire B., Tiercy J.M.;
RT   "Sequence of a new B*57 variant allele";
RL   Unpublished.
XX
DR   MD5; 65ee3651b3676a1f6f7016972e5bea17.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..792
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /cell_type="lymphocytes"
FT                   /tissue_type="peripheral blood"
FT                   /db_xref="taxon:9606"
FT   CDS             join(<1..270,517..>792)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*57v"
FT                   /product="MHC class II antigen"
FT                   /function="antigen presentation"
FT                   /note="The sequence of intron 2 separating exons 2 and 3
FT                   has not been determined, the length of intron 2 (246 bp) is
FT                   based on the genomic sequence of the most closely related
FT                   allele HLA-B*570101"
FT                   /db_xref="GOA:A8E1W1"
FT                   /db_xref="IMGT/HLA:B*57:16"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:A8E1W1"
FT                   /protein_id="CAP09889.1"
FT                   /translation="SHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRME
FT                   PRAPWIEQEGPEYWDGETRNMKASAQTYRENLRIALRYYNQSEAGSHIIQVMYGCDVGP
FT                   DGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQLRAYLEGLC
FT                   VEWLRRYLENGKETLQRA"
FT   exon            <1..270
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*57v"
FT                   /number=2
FT   intron          271..516
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*57v"
FT                   /number=2
FT   exon            517..>792
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*57v"
FT                   /number=3
XX
SQ   Sequence 792 BP; 106 A; 169 C; 196 G; 75 T; 246 other;
     gctcccactc catgaggtat ttctacaccg ccatgtcccg gcccggccgc ggggagcccc        60
     gcttcatcgc agtgggctac gtggacgaca cccagttcgt gaggttcgac agcgacgccg       120
     cgagtccgag gatggagccc cgggcgccat ggatagagca ggaggggccg gagtattggg       180
     acggggagac acggaacatg aaggcctccg cgcagactta ccgagagaac ctgcggatcg       240
     cgctccgcta ctacaaccag agcgaggccg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       420
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       480
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnggtc tcacatcatc caggtgatgt       540
     atggctgcga cgtggggccg gacgggcgcc tcctccgcgg gcatgaccag tccgcctacg       600
     acggcaagga ttacatcgcc ctgaacgagg acctgagctc ctggaccgcg gcggacacgg       660
     cggctcagat cacccagcgc aagtgggagg cggcccgtgt ggcggagcag ctgagagcct       720
     acctggaggg cctgtgcgtg gagtggctcc gcagatacct ggagaacggg aaggagacgc       780
     tgcagcgcgc gg                                                           792
//


spacer
spacer