spacer

EBI Dbfetch

ID   AM850138; SV 1; linear; genomic DNA; STD; HUM; 952 BP.
XX
AC   AM850138;
XX
DT   31-AUG-2007 (Rel. 93, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens partial HLA-B gene for MHC class I antigen, HLA-B*57new
DE   allele, exons 2-3
XX
KW   HLA-B gene; HLA-B*57new allele; major histocompatibility complex;
KW   MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-952
RA   Altermann W.W.;
RT   ;
RL   Submitted (30-AUG-2007) to the INSDC.
RL   Altermann W.W., Interbranch HLA-Lab, Martin-Luther-University, Medical
RL   School, Magdeburger Str. 16, D-06097 Halle, GERMANY.
XX
RN   [2]
RX   DOI; 10.1111/j.1399-0039.2007.00999.x.
RX   PUBMED; 18194362.
RA   Altermann W.W., Grondkowski V., Reichert S., Seliger B., Schlaf G.;
RT   "A novel HLA-B*57 (B*5714) allele in a healthy male Caucasian individual";
RL   Tissue Antigens 71(3):253-254(2008).
XX
DR   MD5; b08e56d2cde2669126550c333a56d798.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..952
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21"
FT                   /mol_type="genomic DNA"
FT                   /country="Germany"
FT                   /tissue_type="blood"
FT                   /db_xref="taxon:9606"
FT   intron          <1..104
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*57new"
FT                   /number=1
FT   CDS             join(<105..374,621..>896)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*57new"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:A7WPI6"
FT                   /db_xref="IMGT/HLA:B*57:14"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:A7WPI6"
FT                   /protein_id="CAO98858.1"
FT                   /translation="SHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRMA
FT                   PRAPWIEQEGPEYWDGETRNMKASAQTYRENLRIALRYYNQSEAGSHIIQVMYGCDVGP
FT                   DGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQLRAYLEGLC
FT                   VEWLRRHLENGKETLQRA"
FT   exon            105..374
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*57new"
FT                   /number=2
FT   intron          375..620
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*57new"
FT                   /number=2
FT   exon            621..896
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*57new"
FT                   /number=3
FT   intron          897..>952
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*57new"
FT                   /number=3
XX
SQ   Sequence 952 BP; 160 A; 314 C; 354 G; 124 T; 0 other;
     tgcctctgta gggaggagca aggggaccgc aggcgggggc gcaggacccg gggagccgcg        60
     ccgggaggag ggtcgggcgg gtctcagccc ctcctcgccc ccaggctccc actccatgag       120
     gtatttctac accgccatgt cccggcccgg ccgcggggag ccccgcttca tcgcagtggg       180
     ctacgtggac gacacccagt tcgtgaggtt cgacagcgac gccgcgagtc cgaggatggc       240
     gccccgggcg ccatggatag agcaggaggg gccggagtat tgggacgggg agacacggaa       300
     catgaaggcc tccgcgcaga cttaccgaga gaacctgcgg atcgcgctcc gctactacaa       360
     ccagagcgag gccggtgagt gaccccggcc cggggcgcag gtcacgactc cccatccccc       420
     acgtacggcc cgggtcgccc cgagtctccg ggtccgagat ccacccccct gaggccgcgg       480
     gacccgccca gaccctcgac cggcgagagc cccaggcgcg tttacccggt ttcattttca       540
     gttgaggcca aaatccccgc gggttggtca gggcggggcg gggctcgggg ggacggggct       600
     gaccgcgggg ccggggccag ggtctcacat catccaggtg atgtatggct gcgacgtggg       660
     gccggacggg cgcctcctcc gcgggcatga ccagtccgcc tacgacggca aggattacat       720
     cgccctgaac gaggacctga gctcctggac cgcggcggac accgcggctc agatcaccca       780
     gcgcaagtgg gaggcggccc gtgtggcgga gcagctgaga gcctacctgg agggcctgtg       840
     cgtggagtgg ctccgcagac acctggagaa cgggaaggag acgctgcagc gcgcgggtac       900
     caggggcagt ggggagcctt ccccatctcc tataggtcgc cgggggatgg ca               952
//


spacer
spacer