spacer

EBI Dbfetch

ID   AM849815; SV 1; linear; genomic DNA; STD; HUM; 1412 BP.
XX
AC   AM849815;
XX
DT   29-AUG-2007 (Rel. 93, Created)
DT   27-OCT-2009 (Rel. 102, Last updated, Version 3)
XX
DE   Homo sapiens partial HLA-B gene for MHC class I antigen, HLA-B*51 allele,
DE   exons 1-5
XX
KW   HLA-B gene; HLA-B*51 allele; human leucocyte antigen B;
KW   major histocompatibility complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1412
RA   Anholts J.D.H.;
RT   ;
RL   Submitted (27-AUG-2007) to the INSDC.
RL   Anholts J.D.H., Immunohematology and bloodtransfusion, Leiden University
RL   Medical Center, Albinusdreef 2, 2333 ZA, NETHERLANDS.
XX
RN   [2]
RX   DOI; 10.1111/j.1399-0039.2009.01334.x.
RX   PUBMED; 19744147.
RA   Anholts J.D., Aneq M., Dirks H.L., Tas A., Verduyn W., Oudshoorn M.;
RT   "Thirty-six novel HLA alleles: 7 HLA-A, 11 HLA-B, 15 HLA-C and 3 HLA-DRB1";
RL   Tissue Antigens 74(5):424-428(2009).
XX
DR   MD5; 591341d06e410cb72e896e7d3533d8f9.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1412
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /tissue_type="blood"
FT                   /db_xref="taxon:9606"
FT   CDS             join(1..73,174..443,544..819,920..1195,1296..>1412)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*51"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:A7MAP7"
FT                   /db_xref="IMGT/HLA:B*51:51"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:A7MAP7"
FT                   /protein_id="CAO98751.1"
FT                   /translation="MRVTAPRTVLLLLWGAVALTETWAGSHSMRYFYTAMSRPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASPRTEPRAPWIEQEGPEYWDRNTQIFKTNTQTYRENLRI
FT                   ALRYYNQSEAGSHTWQTMYGCDVGPDGRLLRGHNQYAYDGKDYIALNEDLSSWTAADTA
FT                   AQITQRKWEAAREAEQLRAYLEGLCVEWLRRHLENGKETLQRADPPKTHVTHHPVSDHE
FT                   TTLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQSTIPIVGIVAGLAVLAVVVIGAVVATVMCRRKSS"
FT   exon            1..73
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*51"
FT                   /number=1
FT   intron          74..173
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*51"
FT                   /number=1
FT   exon            174..443
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*51"
FT                   /number=2
FT   intron          444..543
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*51"
FT                   /number=2
FT   exon            544..819
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*51"
FT                   /number=3
FT   intron          820..919
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*51"
FT                   /number=3
FT   exon            920..1195
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*51"
FT                   /number=4
FT   intron          1196..1295
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*51"
FT                   /number=4
FT   exon            1296..1412
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*51"
FT                   /number=5
XX
SQ   Sequence 1412 BP; 210 A; 314 C; 331 G; 157 T; 400 other;
     atgcgggtca cggcgccccg aaccgtcctc ctgctgctct ggggggcagt ggccctgacc        60
     gagacctggg ccgnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       120
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnngctccca       180
     ctccatgagg tatttctaca ccgccatgtc ccggcccggc cgcggggagc cccgcttcat       240
     tgcagtgggc tacgtggacg acacccagtt cgtgaggttc gacagcgacg ccgcgagtcc       300
     gaggacggag ccccgggcgc catggataga gcaggagggg ccggagtatt gggaccggaa       360
     cacacagatc ttcaagacca acacacagac ttaccgagag aacctgcgga tcgcgctccg       420
     ctactacaac cagagcgagg ccgnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       480
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       540
     nnnggtctca cacttggcag acgatgtatg gctgcgacgt ggggccggac gggcgcctcc       600
     tccgcgggca taaccagtac gcctacgacg gcaaagatta catcgccctg aacgaggacc       660
     tgagctcctg gaccgcggcg gacaccgcgg ctcagatcac ccagcgcaag tgggaggcgg       720
     cccgtgaggc ggagcagctg agagcctacc tggagggcct gtgcgtggag tggctccgca       780
     gacacctgga gaacgggaag gagacgctgc agcgcgcggn nnnnnnnnnn nnnnnnnnnn       840
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       900
     nnnnnnnnnn nnnnnnnnna ccccccaaag acacacgtga cccaccaccc cgtctctgac       960
     catgagacca ccctgaggtg ctgggccctg ggcttctacc ctgcggagat cacactgacc      1020
     tggcagcggg atggcgagga ccaaactcag gacactgagc ttgtggagac cagaccagca      1080
     ggagatagaa ccttccagaa gtgggcagct gtggtggtgc cttctggaga agagcagaga      1140
     tacacatgcc atgtacagca tgaggggctg ccgaagcccc tcaccctgag atgggnnnnn      1200
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1260
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnagcca tcttcccagt ccaccatccc      1320
     catcgtgggc attgttgctg gcctggctgt cctagcagtt gtggtcatcg gagctgtggt      1380
     cgctactgtg atgtgtagga ggaagagctc ag                                    1412
//


spacer
spacer