spacer

EBI Dbfetch

ID   AM849481; SV 1; linear; genomic DNA; STD; HUM; 3142 BP.
XX
AC   AM849481;
XX
DT   29-AUG-2007 (Rel. 93, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 2)
XX
DE   Homo sapiens HLA-A gene for MHC class I antigen, HLA-A*03new allele, exons
DE   1-8
XX
KW   HLA-A gene; HLA-A*03new allele; human leucocyte antigen A;
KW   major histocompatibility complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-3142
RA   Dormoy A.;
RT   ;
RL   Submitted (23-AUG-2007) to the INSDC.
RL   Dormoy A., Laboratoire HLA, Etablissement Francais du Sang - Alsace, 10 rue
RL   Spielmann, 67000, FRANCE.
XX
RN   [2]
RA   Dormoy A., Froelich N.;
RT   "The new HLA-A*03 allele has been highlighted after a discrepant result has
RT   been obtained between serological and molecular testings.";
RL   Unpublished.
XX
DR   MD5; c5889d985a6d5ac0f86ee9a5f1449762.
DR   Ensembl-Gn; ENSG00000206503; homo_sapiens.
DR   Ensembl-Tr; ENST00000376809; homo_sapiens.
DR   Ensembl-Tr; ENST00000396634; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3142
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   mRNA            join(<232..304,435..677,919..1194,1773..2048,2151..2267,
FT                   2710..2742,2885..2932,3102..>3106)
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*03new"
FT   CDS             join(232..304,435..677,919..1194,1773..2048,2151..2267,
FT                   2710..2742,2885..2932,3102..3106)
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*03new"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:A7MAP4"
FT                   /db_xref="IMGT/HLA:A*03:36N"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:A7MAP4"
FT                   /protein_id="CAO98726.1"
FT                   /translation="MAVMAPRTLLLLLSGALALTQTWAGSHSMRYFFTSVSRPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDQETDRVDLGTLRGYYNQSE
FT                   AGSHTIQIMYGCDVGSDGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMAAQITKRKWE
FT                   AAHEAEQLRAYLDGTCVEWLRRYLENGKETLQRTDPPKTHMTHHPISDHEATLRCWALG
FT                   FYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGL
FT                   PKPLTLRWELSSQPTIPIVGIIAGLVLLGAVITGAVVAAVMWRRKSSDRKGGSYTQAAS
FT                   SDSAQGSDVSLTACKV"
FT   exon            <232..304
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*03new"
FT                   /number=1
FT   intron          305..434
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*03new"
FT                   /number=1
FT   exon            435..677
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*03new"
FT                   /number=2
FT                   /note="contains a deletion"
FT   intron          678..918
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*03new"
FT                   /number=2
FT   exon            919..1194
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*03new"
FT                   /number=3
FT   intron          1195..1772
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*03new"
FT                   /number=3
FT   exon            1773..2048
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*03new"
FT                   /number=4
FT   intron          2049..2150
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*03new"
FT                   /number=4
FT   exon            2151..2267
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*03new"
FT                   /number=5
FT   intron          2268..2709
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*03new"
FT                   /number=5
FT   exon            2710..2742
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*03new"
FT                   /number=6
FT   intron          2743..2884
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*03new"
FT                   /number=6
FT   exon            2885..2932
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*03new"
FT                   /number=7
FT   intron          2933..3101
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*03new"
FT                   /number=7
FT   exon            3102..>3106
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*03new"
FT                   /number=8
XX
SQ   Sequence 3142 BP; 596 A; 904 C; 976 G; 666 T; 0 other;
     gcggtgtatg gattggggag tcccagcctt ggggattccc caactccgca gtttcttttc        60
     tccctctccc aacctacgta gggtccttca tcctggatac tcacgacgcg gacccagttc       120
     tcactcccat tgggtgtcgg gtttccagag aagccaatca gtgtcgtcgc ggtcgctgtt       180
     ctaaagcccg cacgcaccca ccgggactca gattctcccc agacgccgag gatggccgtc       240
     atggcgcccc gaaccctcct cctgctactc tcgggggccc tggccctgac ccagacctgg       300
     gcgggtgagt gcggggtcgg gagggaaacc gcctctgcgg ggagaagcaa ggggccctcc       360
     tggcgggggc gcaggaccgg gggagccgcg ccgggacgag ggtcgggcag gtctcagcca       420
     ctgctcgccc ccaggctccc actccatgag gtatttcttc acatccgtgt cccggcccgg       480
     ccgcggggag ccccgcttca tcgccgtggg ctacgtggac gacacgcagt tcgtgcggtt       540
     cgacagcgac gccgcgagcc agaggatgga gccgcgggcg ccgtggatag agcaggaggg       600
     gccggagtat tgggaccagg agactgaccg agtggacctg gggaccctgc gcggctacta       660
     caaccagagc gaggccggtg agtgaccccg gccgggggcg caggtcagga cccctcatcc       720
     cccacggacg ggccaggtcg cccacagtct ccgggtccga gatccacccc gaagccgcgg       780
     gaccccgaga cccttgcccc gggagaggcc caggcgcctt tacccggttt cattttcagt       840
     ttaggccaaa aatccccccg ggttggtcgg ggctgggcgg ggctcggggg actgggctga       900
     ccgcggggtc ggggccaggt tctcacacca tccagataat gtatggctgc gacgtggggt       960
     cggacgggcg cttcctccgc gggtaccggc aggacgccta cgacggcaag gattacatcg      1020
     ccctgaacga ggacctgcgc tcttggaccg cggcggacat ggcggctcag atcaccaagc      1080
     gcaagtggga ggcggcccat gaggcggagc agttgagagc ctacctggat ggcacgtgcg      1140
     tggagtggct ccgcagatac ctggagaacg ggaaggagac gctgcagcgc acgggtacca      1200
     ggggccacgg ggcgcctccc tgatcgcctg tagatctccc gggctggcct cccacaagga      1260
     ggggagacaa ttgggaccaa cactagaata tcaccctccc tctggtcctg agggagagga      1320
     atcctcctgg gttccagatc ctgtaccaga gagtgactct gaggttccgc cctgctctct      1380
     gacacaatta agggataaaa tctctgaagg agtgacggga agacgatccc tcgaatactg      1440
     atgagtggtt ccctttgaca ccggcagcag ccttgggccc gtgacttttc ctctcaggcc      1500
     ttgttctctg cttcacactc aatgtgtgtg ggggtctgag tccagcactt ctgagtccct      1560
     cagcctccac tcaggtcagg accagaagtc gctgttccct tctcagggaa tagaagatta      1620
     tcccaggtgc ctgtgtccag gctggtgtct gggttctgtg ctctcttccc catcccgggt      1680
     gtcctgtcca ttctcaagat ggccacatgc gtgctggtgg agtgtcccat gacagatgca      1740
     aaatgcctga attttctgac tcttcccgtc agaccccccc aagacacata tgacccacca      1800
     ccccatctct gaccatgagg ccaccctgag gtgctgggcc ctgggcttct accctgcgga      1860
     gatcacactg acctggcagc gggatgggga ggaccagacc caggacacgg agctcgtgga      1920
     gaccaggcct gcaggggatg gaaccttcca gaagtgggcg gctgtggtgg tgccttctgg      1980
     agaggagcag agatacacct gccatgtgca gcatgagggt ctgcccaagc ccctcaccct      2040
     gagatggggt aaggagggag atgggggtgt catgtctctt agggaaagca ggagcctctc      2100
     tggagacctt tagcagggtc agggcccctc accttcccct cttttcccag agctgtcttc      2160
     ccagcccacc atccccatcg tgggcatcat tgctggcctg gttctccttg gagctgtgat      2220
     cactggagct gtggtcgctg ccgtgatgtg gaggaggaag agctcaggtg gagaaggggt      2280
     gaagggtggg gtctgagatt tcttgtctca ctgagggttc caagccccag ctagaaatgt      2340
     gccctgtctc attactggga agcaccgtcc acaatcatgg gcctacccag tctgggccct      2400
     gtgtgccagc acttactctt ttgtaaagca cctgttaaaa tgaaggacag atttatcacc      2460
     ttgattacgg cggtgatggg acctgatccc agcagtcaca agtcacaggg gaaggtccct      2520
     gaggacagac ctcaggaggg ctattggtcc aggacccaca cctgctttct tcatgtttcc      2580
     tgatcccgcc ctgggtctgc agtcacacat ttctggaaac ttctctgggg tccaagacta      2640
     ggaggttcct ctaggacctt aaggccctgg ctcctttctg gtatctcaca ggacattttc      2700
     ttctcacaga tagaaaagga gggagttaca ctcaggctgc aagtaagtat gaaggaggct      2760
     gatgcctgag gtccttggga tattgtgttt gggagcccat gggggagccc acccacctca      2820
     caattcctcc tctagccaca tcttctgtgg gatctgacca ggttctgttt ttgttctacc      2880
     ccaggcagtg acagtgccca gggctctgat gtgtccctca cagcttgtaa aggtgagagc      2940
     ttggaggacc taatgtgtgt tgggtgttgg gcggaacagt ggacacagct gtgctatggg      3000
     gtttctttgc attggatgta ttgagcatgc gatgggctgt ttaaggtgtg acccctcact      3060
     gtgatggata tgaatttgtt catgaatatt tttttctata gtgtgagaca gctgccttgt      3120
     gtgggactga gaggcaagag tt                                               3142
//


spacer
spacer