spacer

EBI Dbfetch

ID   AM849480; SV 1; linear; genomic DNA; STD; HUM; 1910 BP.
XX
AC   AM849480;
XX
DT   29-AUG-2007 (Rel. 93, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 2)
XX
DE   Homo sapiens partial HLA-A gene for truncated MHC class I antigen,
DE   HLA-A*24nul allele, exons 1-5
XX
KW   HLA-A gene; HLA-A*24nul allele; human leucocyte antigen A;
KW   major histocompatibility complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1910
RA   Dormoy A.;
RT   ;
RL   Submitted (23-AUG-2007) to the INSDC.
RL   Dormoy A., Laboratoire HLA, Etablissement Francais du Sang - Alsace, 10 rue
RL   Spielmann, 67000, FRANCE.
XX
RN   [2]
RA   Dormoy A., Weschler B., Leisenbach R., Pedron B.;
RT   "The HLA-A*24nul allele has 1 nucleotide change from the A*24020101 allele
RT   in exon 4 where C->A (TAC -> TAA) resulting in a stop codon.";
RL   Unpublished.
XX
DR   MD5; d9699e549cd3af46cdcaff00477b38cb.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1910
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /PCR_primers="fwd_name: P5' Ala A-1, fwd_seq:
FT                   tgacccagacctgggca, rev_name: P3' Intron 6A, rev_seq:
FT                   cccacagaasatgtggctag"
FT                   /db_xref="taxon:9606"
FT   mRNA            join(<1..2,133..402,644..919,1499..1774,1877..>1910)
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*24nul"
FT   CDS             join(<1..2,133..402,644..919,1499..1578)
FT                   /codon_start=2
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*24nul"
FT                   /product="truncated MHC class I antigen"
FT                   /db_xref="GOA:A7MAP3"
FT                   /db_xref="IMGT/HLA:A*24:83N"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:A7MAP3"
FT                   /protein_id="CAO98725.1"
FT                   /translation="GSHSMRYFSTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRM
FT                   EPRAPWIEQEGPEYWDEETGKVKAHSQTDRENLRIALRYYNQSEAGSHTLQMMFGCDVG
FT                   SDGRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQITKRKWEAAHVAEQQRAYLEGT
FT                   CVDGLRRYLENGKETLQRTDPPKTHMTHHPISDHEATLRCWALGF"
FT   exon            <1..2
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*24nul"
FT                   /number=1
FT   intron          3..132
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*24nul"
FT                   /number=1
FT   exon            133..402
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*24nul"
FT                   /number=2
FT   intron          403..643
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*24nul"
FT                   /number=2
FT   exon            644..919
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*24nul"
FT                   /number=3
FT   intron          920..1498
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*24nul"
FT                   /number=3
FT   exon            1499..1774
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*24nul"
FT                   /number=4
FT   variation       1578
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*24020101"
FT                   /replace="c"
FT                   /compare=L47206.1
FT                   /note="taa stop codon -> tac (Tyr)"
FT   intron          1775..1876
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*24nul"
FT                   /number=4
FT   exon            1877..>1910
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*24nul"
FT                   /number=5
XX
SQ   Sequence 1910 BP; 367 A; 587 C; 618 G; 337 T; 1 other;
     aggtgagtgc ggggtcggga gggaaacggc ctctgcgggg agaagcaagg ggcccgcctg        60
     gcgggggcgc aagacccggg aagccgcgcc gggaggaggg tcgggcgggt ctcagccact       120
     cctcgtcccc aggctcccac tccatgaggt atttctccac atccgtgtcc cggcccggcc       180
     gcggggagcc ccgcttcatc gccgtgggct acgtggacga cacgcagttc gtgcggttcg       240
     acagcgacgc cgcgagccag aggatggagc cgcgggcgcc gtggatagag caggaggggc       300
     cggagtattg ggacgaggag acagggaaag tgaaggccca ctcacagact gaccgagaga       360
     acctgcggat cgcgctccgc tactacaacc agagcgaggc cggtgagtga ccccggcccg       420
     gggcgcaggt cacgacccct catcccccac ggacgggccg ggtcgcccac agtctccggg       480
     tccgagatcc accccgaagc cgcgggaccc cgagaccctt gccccgggag aggcccaggc       540
     gccttaaccc ggtttcattt tcagtttagg ccaaaaatcc ccccgggttg gtcggggccg       600
     ggcggggctc gggggactgg gctgaccgcg gggtcggggc caggttctca caccctccag       660
     atgatgtttg gctgcgacgt ggggtcggac gggcgcttcc tccgcgggta ccaccagtac       720
     gcctacgacg gcaaggatta catcgccctg aaagaggacc tgcgctcttg gaccgcggcg       780
     gacatggcgg ctcagatcac caagcgcaag tgggaggcgg cccatgtggc ggagcagcag       840
     agagcctacc tggagggcac gtgcgtggac gggctccgca gatacctgga gaacgggaag       900
     gagacgctgc agcgcacggg taccaggggc cacggggcgc ctacctgatc gcctgtaggt       960
     ctcccgggct ggcctcccac aaggagggga gacaattggg accaacacta gaatatcgcc      1020
     ctccctctgg tcctgaggga gaggaatcct cctgggtttc cagatcctgt accagagagt      1080
     gactctgagg ttccgccctg ctctctgaca caattaaggg ataaaatctc tgacggaatg      1140
     acggaaagac gatccctcga atactgatga ctggttccct ttgacaccgg cagcagcctt      1200
     gggaccgtga cttttcctct caggccttgt tctctgcttc acactcaatg tgtgtggggg      1260
     tctgagtcca gcacttctga gtccctcagc ctccactcag gtcaggacca gaagtcgctg      1320
     ttccctcctc agggaataga agattatccc aggtgcctgt gtccaggctg gtgtctgggt      1380
     tctgtgctct cttccccatc ccgggtgtcc tgtccattct caagatggcc acatgcatgs      1440
     tggtggagtg tcccatgaca gatgcaaaat gcctgaattt tctgactctt cccgtcagac      1500
     ccccccaaga cacatatgac ccaccacccc atctctgacc atgaggccac tctgagatgc      1560
     tgggccctgg gcttctaacc tgcggagatc acactgacct ggcagcggga tggggaggac      1620
     cagacccagg acacggagct tgtggagacc aggcctgcag gggatggaac cttccagaag      1680
     tgggcagctg tggtggtacc ttctggagag gagcagagat acacctgcca tgtgcagcat      1740
     gagggtctgc ccaagcccct caccctgaga tggggtaagg agggagatgg gggtgtcatg      1800
     tctcttaggg aaagcaggag cctctctgga gacctttagc agggtcaggg cccctcacct      1860
     tcccctcttt tcccagagcc atcttcccag cccaccgtcc ccatcgtggg                 1910
//


spacer
spacer