spacer

EBI Dbfetch

ID   AM849479; SV 1; linear; genomic DNA; STD; HUM; 1712 BP.
XX
AC   AM849479;
XX
DT   29-AUG-2007 (Rel. 93, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 2)
XX
DE   Homo sapiens partial HLA-A gene for MHC class I antigen, HLA-A*02new
DE   allele, exons 1-5
XX
KW   HLA-A gene; HLA-A*02new allele; human leucocyte antigen A;
KW   major histocompatibility complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1712
RA   Dormoy A.;
RT   ;
RL   Submitted (23-AUG-2007) to the INSDC.
RL   Dormoy A., Laboratoire HLA, Etablissement Francais du Sang - Alsace, 10 rue
RL   Spielmann, 67000, FRANCE.
XX
RN   [2]
RA   Dormoy A., Weschler B., Froelich N.;
RT   "The HLA-A*02 new allele has 1 nucleotide change from the A*02010101 allele
RT   where G->A (GCT->ACT) resulting in a coding change, Ala is changed to Thr
RT   in A*02new.";
RL   Unpublished.
XX
DR   MD5; eaa2c3cfe6860813ef5081f93b9b4d38.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1712
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /PCR_primers="fwd_name: P5' Ala T-9, fwd_seq:
FT                   ctgctactctcgggggct, rev_name: P3' Intron 6A, rev_seq:
FT                   cccacagaasatgtggctag"
FT                   /db_xref="taxon:9606"
FT   CDS             join(<1..26,157..426,595..870,1318..1593,1693..>1712)
FT                   /codon_start=2
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02new"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:A7MAP2"
FT                   /db_xref="IMGT/HLA:A*02:132"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:A7MAP2"
FT                   /protein_id="CAO98724.1"
FT                   /translation="LALTQTWAGSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFD
FT                   SDAASQRMEPRAPWIEQEGPEYWDGETRKVKAHSQTHRVDLGTLRGYYNQSEAGSHTVQ
FT                   RMYGCDVGSDWRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQTTKHKWEAAHVAEQ
FT                   LRAYLEGTCVEWLRRYLENGKETLQRTDAPKTHMTHHAVSDHEATLRCWALSFYPAEIT
FT                   LTWQRDGEDQTQDTELVETRPAGDGTFQKWATVVVPSGQEQRYTCHVQHEGLPKPLTLR
FT                   WEPSSQPT"
FT   exon            <1..26
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02new"
FT                   /number=1
FT   intron          27..156
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02new"
FT                   /number=1
FT   exon            157..426
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02new"
FT                   /number=2
FT   intron          427..594
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02new"
FT                   /number=2
FT   exon            595..870
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02new"
FT                   /number=3
FT   intron          871..1317
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02new"
FT                   /number=3
FT   exon            1318..1593
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02new"
FT                   /number=4
FT   variation       1506
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02010101"
FT                   /replace="g"
FT                   /compare=AJ555412.1
FT                   /note="ACT Thr -> GCT Ala"
FT   intron          1594..1692
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02new"
FT                   /number=4
FT   exon            1693..>1712
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02new"
FT                   /number=5
XX
SQ   Sequence 1712 BP; 338 A; 522 C; 564 G; 288 T; 0 other;
     tctggccctg acccagacct gggcgggtga gtgcggggtc gggagggaaa cggcctctgt        60
     ggggagaagc aacgggcccg cctggcgggg gcgcaggacc cgggaagccg cgccgggagg       120
     agggtcgggc gggtctcagc cactcctcgt ccccaggctc tcactccatg aggtatttct       180
     tcacatccgt gtcccggccc ggccgcgggg agccccgctt catcgcagtg ggctacgtgg       240
     acgacacgca gttcgtgcgg ttcgacagcg acgccgcgag ccagaggatg gagccgcggg       300
     cgccgtggat agagcaggag ggtccggagt attgggacgg ggagacacgg aaagtgaagg       360
     cccactcaca gactcaccga gtggacctgg ggaccctgcg cggctactac aaccagagcg       420
     aggccggtga gtgaccccgg cccggggcgc aggtcacgac ctctcatccc ccacggacgg       480
     gccaggtcgc ccacagtctc cgggtccgag atccgccccg aagccgcggg accccgagac       540
     ccttgccccg ggagaggccc agggggaccg ggctgaccgc ggggtccggg ccaggttctc       600
     acaccgtcca gaggatgtat ggctgcgacg tggggtcgga ctggcgcttc ctccgcgggt       660
     accaccagta cgcctacgac ggcaaggatt acatcgccct gaaagaggac ctgcgctctt       720
     ggaccgcggc ggacatggca gctcagacca ccaagcacaa gtgggaggcg gcccatgtgg       780
     cggagcagtt gagagcctac ctggagggca cgtgcgtgga gtggctccgc agatacctgg       840
     agaacgggaa ggagacgctg cagcgcacgg gtaccagggg ccacggggcg cctccctgat       900
     cgcctgtaga tctcccgggc tggcctccca caaggagggg agacaattgg gaccaacact       960
     agaatatcgc cctccctctg gtcctgaggg agaggaatcc tcctgggttt ccagatcctg      1020
     taccagagag tgactctgag gttccgccct gctctctgac acaattaagg gataaaatct      1080
     ctgaaggaat gacgggaaga cgatccctcg aatactgatg agtggttccc tttgacacac      1140
     acagtttcca cggaatagga gattatccca ggtgcctgtg tccaggctgg tgtctgggtt      1200
     ctgtgctccc ttccccatcc caggtgtcct gtccattctc aagatagcca catgtgtgct      1260
     ggaggagtgt cccatgacag atgcaaaatg cctgaatgat ctgactcttc ctgacagacg      1320
     cccccaaaac gcatatgact caccacgctg tctctgacca tgaagccacc ctgaggtgct      1380
     gggccctgag cttctaccct gcggagatca cactgacctg gcagcgggat ggggaggacc      1440
     agacccagga cacggagctc gtggagacca ggcctgcagg ggatggaacc ttccagaagt      1500
     gggcgactgt ggtggtgcct tctggacagg agcagagata cacctgccat gtgcagcatg      1560
     agggtttgcc caagcccctc accctgagat ggggtaagga gggagacggg ggtgtcatgt      1620
     cttttaggga aagcaggagc ctctctgacc tttagcaggg tcagggcccc tcaccttccc      1680
     ctcttttccc agagccgtct tcccagccca cc                                    1712
//


spacer
spacer