spacer

EBI Dbfetch

ID   AM773422; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   AM773422;
XX
DT   31-JUL-2007 (Rel. 92, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 2)
XX
DE   Homo sapiens partial HLA-DRB1 gene for MHC class II antigen, HLA-DRB1*04new
DE   allele, exon 2
XX
KW   HLA-DRB1 gene; HLA-DRB1*04new allele; human leucocyte antigen D;
KW   major histocompatibility complex; MHC class II antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   McWhinnie A.J.M.;
RT   ;
RL   Submitted (17-JUL-2007) to the INSDC.
RL   McWhinnie A.J.M., Research Institute, Anthony Nolan Trust, Royal Free
RL   Hospital, Hampstead, London, NW3 2QG, UNITED KINGDOM.
XX
RN   [2]
RA   Wallis-Jones S., McWhinnie A.J.M., Little A.M.;
RT   "HLA-DRB1 exon 2 sequence of a new DRB1*04 allele DRB1*04xx";
RL   Unpublished.
XX
DR   MD5; c6b786c24bc6f82459a77a7b1e1cac0a.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /tissue_type="peripheral blood"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*04new"
FT                   /product="MHC class II antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:A7DZ95"
FT                   /db_xref="IMGT/HLA:DRB1*04:66"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:A7DZ95"
FT                   /protein_id="CAO79098.1"
FT                   /translation="RFLEQAKSECHFFNGTERVRFLDRYFYHQEEYVRFDSDVGEYRAV
FT                   TELGRPDAEYWNSQKDLLEQKRAAVDTYCRHNYGVGESFTVQRR"
FT   exon            1..270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*04new"
FT                   /number=2
XX
SQ   Sequence 270 BP; 58 A; 66 C; 98 G; 48 T; 0 other;
     cacgtttctt ggagcaggct aagtctgagt gtcatttctt caacgggacg gagcgggtgc        60
     ggttcctgga cagatacttc tatcaccaag aggagtacgt gcgcttcgac agcgacgtgg       120
     gggagtaccg ggcggtgacg gagctggggc ggcctgatgc cgagtactgg aacagccaga       180
     aggacctcct ggagcagaag cgggccgcgg tggacaccta ctgcagacac aactacgggg       240
     ttggtgagag cttcacagtg cagcggcgag                                        270
//


spacer
spacer