Dbfetch

ID   AM765992; SV 1; linear; genomic DNA; STD; HUM; 381 BP.
XX
AC   AM765992;
XX
DT   16-JUL-2007 (Rel. 92, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens partial HLA-DRB1 gene MHC class II antigen, HLA-DRB1*04new
DE   allele, exon 2
XX
KW   HLA-DRB1 gene; HLA-DRB1*04new allele; human leucocyte antigen DRB1;
KW   major histocompatibility complex; MHC class II antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-381
RA   Witter K.;
RT   ;
RL   Submitted (13-JUL-2007) to the INSDC.
RL   Witter K., University of Munich, Laboratory of Immunogenetics,
RL   Max-Lebsche-Platz 32, 81377 Munich, GERMANY.
XX
RN   [2]
RX   DOI; 10.1111/j.1399-0039.2007.01001.x.
RX   PUBMED; 18194364.
RA   Witter K., Mautner J., Volgger A., Zahn R., Kauke T.;
RT   "A novel HLA-DRB1 allele, HLA-DRB1*0465, was identified in a Hodgkin's
RT   lymphoma cell line";
RL   Tissue Antigens 71(3):257-258(2008).
XX
DR   MD5; 559aaf74b07a43705753ff12db7b5dee.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..381
FT                   /organism="Homo sapiens"
FT                   /isolate="171877"
FT                   /mol_type="genomic DNA"
FT                   /cell_line="KHM2"
FT                   /db_xref="taxon:9606"
FT   CDS             <73..>329
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*04new"
FT                   /product="MHC class II antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:A7DZ90"
FT                   /db_xref="IMGT/HLA:DRB1*04:65"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:A7DZ90"
FT                   /protein_id="CAO78755.1"
FT                   /translation="RFLEQVKHECHFFNGTERVRFLDRYFYHQEESVRFDSDVGEYRAV
FT                   TELGRPDAEYWNSQKDLLEQWRAEVDTYCRHNYGVVESFT"
FT   exon            73..329
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*04new"
FT                   /number=2
FT   variation       270
FT                   /allele="HLA-DRB1*040601"
FT                   /replace="a"
FT                   /compare=AF029272.1
FT                   /note="Trp to Arg"
XX
SQ   Sequence 381 BP; 69 A; 98 C; 142 G; 72 T; 0 other;
     ggttgcgggt ggggccagat agtgtcttcc ccggaggccg cttctgtaac cggatcgttc        60
     ttgtcccccc agcacgtttc ttggagcagg ttaaacatga gtgtcatttc ttcaacggga       120
     cggagcgggt gcggttcctg gacagatact tctatcacca agaggagtcc gtgcgcttcg       180
     acagcgacgt gggggagtac cgggcggtga cggagctggg gcggcctgat gccgagtact       240
     ggaacagcca gaaggacctc ctggagcagt ggcgggccga ggtggacacc tactgcagac       300
     acaactacgg ggttgtggag agcttcacag tgcagcggcg aggtgagcgc ggcgcggggc       360
     ggggcctgag tccctgtgag c                                                 381
//