spacer

EBI Dbfetch

ID   AM749669; SV 1; linear; genomic DNA; STD; HUM; 1195 BP.
XX
AC   AM749669;
XX
DT   10-JUL-2007 (Rel. 92, Created)
DT   27-OCT-2009 (Rel. 102, Last updated, Version 3)
XX
DE   Homo sapiens partial HLA-B gene for MHC class I antigen, HLA-B*35 allele,
DE   exon 1-4
XX
KW   HLA-B gene; HLA-B*35 allele; human leucocyte antigen B;
KW   major histocompatibility complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1195
RA   Anholts J.D.H.;
RT   ;
RL   Submitted (09-JUL-2007) to the INSDC.
RL   Anholts J.D.H., Immunohematology and bloodtransfusion, Leiden University
RL   Medical Center, Albinusdreef 2, 2333 ZA, NETHERLANDS.
XX
RN   [2]
RX   DOI; 10.1111/j.1399-0039.2009.01334.x.
RX   PUBMED; 19744147.
RA   Anholts J.D., Aneq M., Dirks H.L., Tas A., Verduyn W., Oudshoorn M.;
RT   "Thirty-six novel HLA alleles: 7 HLA-A, 11 HLA-B, 15 HLA-C and 3 HLA-DRB1";
RL   Tissue Antigens 74(5):424-428(2009).
XX
DR   MD5; 61db142ae0004fd95518e53be130bd75.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1195
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /cell_type="B-lymphocyte"
FT                   /tissue_type="peripheral blood"
FT                   /db_xref="taxon:9606"
FT   CDS             join(1..73,174..443,544..819,920..>1195)
FT                   /codon_start=1
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*35"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:A6Q0R2"
FT                   /db_xref="IMGT/HLA:B*35:20:02"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:A6Q0R2"
FT                   /protein_id="CAO78193.1"
FT                   /translation="MRVTAPRTVLLLLWGAVALTETWAGSHSMRYFYTAMSRPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASPRTEPRAPWIEQEGPEYWDRNTQISKTNTQTYRESLRN
FT                   LRGYYNQSEAGSHIIQRMYGCDLGPDGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTA
FT                   AQITQRKWEAARVAEQLRAYLEGLCVEWLRRYLENGKETLQRADPPKTHVTHHPVSDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRW"
FT   exon            1..73
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*35"
FT                   /number=1
FT   intron          74..173
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*35"
FT                   /number=1
FT   exon            174..443
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*35"
FT                   /number=2
FT   intron          444..543
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*35"
FT                   /number=2
FT   exon            544..819
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*35"
FT                   /number=3
FT   intron          820..919
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*35"
FT                   /number=3
FT   exon            920..>1195
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*35"
FT                   /number=4
XX
SQ   Sequence 1195 BP; 187 A; 286 C; 297 G; 125 T; 300 other;
     atgcgggtca cggcgccccg aaccgtcctc ctgctgctct ggggggcagt ggccctgacc        60
     gagacctggg ccgnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       120
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnngctccca       180
     ctccatgagg tatttctaca ccgccatgtc ccggcccggc cgcggggagc cccgcttcat       240
     cgcagtgggc tacgtggacg acacccagtt cgtgaggttc gacagcgacg ccgcgagtcc       300
     gaggacggag ccccgggcgc cgtggataga gcaagagggg ccggagtatt gggaccggaa       360
     cacacagatc tccaagacca acacacagac ttaccgagag agcctgcgga acctgcgcgg       420
     ctactacaac cagagcgagg ccgnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       480
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       540
     nnnggtctca catcatccag aggatgtatg gctgcgacct ggggcccgac gggcgcctcc       600
     tccgcgggca tgaccagtcc gcctacgacg gcaaggatta catcgccctg aacgaggacc       660
     tgagctcctg gaccgcggcg gacaccgcgg ctcagatcac ccagcgcaag tgggaggcgg       720
     cccgtgtggc ggagcagctg agagcctacc tggagggcct gtgcgtggag tggctccgca       780
     gatacctgga gaacgggaag gagacgctgc agcgcgcggn nnnnnnnnnn nnnnnnnnnn       840
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       900
     nnnnnnnnnn nnnnnnnnna ccccccaaag acacacgtga cccaccaccc cgtctctgac       960
     catgaggcca ccctgaggtg ctgggccctg ggcttctacc ctgcggagat cacactgacc      1020
     tggcagcggg atggcgagga ccaaactcag gacactgagc ttgtggagac cagaccagca      1080
     ggagatagaa ccttccagaa gtgggcagct gtggtggtgc cttctggaga agagcagaga      1140
     tacacatgcc atgtacagca tgaggggctg ccgaagcccc tcaccctgag atggg           1195
//


spacer
spacer