spacer

EBI Dbfetch

ID   AM747815; SV 1; linear; genomic DNA; STD; HUM; 2229 BP.
XX
AC   AM747815;
XX
DT   27-JUN-2007 (Rel. 92, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 2)
XX
DE   Homo sapiens partial HLA-B gene for MHC class I antigen, HLA-B*3501new
DE   allele, exons 1-5
XX
KW   HLA-B gene; HLA-B*3501new allele; major histocompatibility complex;
KW   MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-2229
RA   Cox S.T.;
RT   ;
RL   Submitted (20-JUN-2007) to the INSDC.
RL   Cox S.T., The Royal Free Hospital, Anthony Nolan Research Institute, Pond
RL   Street, Hampstead, London, NW3 2QG, UNITED KINGDOM.
XX
RN   [2]
RA   Cox S.T.;
RT   "New HLA allele";
RL   Unpublished.
XX
DR   MD5; 184b8c0cc7c26b3d4732bd89d267c688.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2229
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             join(<1..40,170..439,685..960,1536..1811,1916..>2032)
FT                   /codon_start=1
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*3501new"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:A6H567"
FT                   /db_xref="IMGT/HLA:B*35:78"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:A6H567"
FT                   /protein_id="CAO00631.1"
FT                   /translation="LLWGAVALTETWAGSHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQ
FT                   FVRFDSDAASPRTEPRAPWIEQEGPEYWDRNTQIFKANTQTYRESLRNLRGYYNQSEAG
FT                   SHIIQRMYGCDLGPDGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAA
FT                   RVAEQLRAYLEGLCVEWLRRYLENGKETLQRADPPKTHVTHHPVSDHEATLRCWALGFY
FT                   PAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPK
FT                   PLTLRWEPSSQSTIPIVGIVAGLAVLAVVVIGAVVATVMCRRKSS"
FT   exon            1..40
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*3501new"
FT                   /number=1
FT   intron          41..169
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*3501new"
FT                   /number=1
FT   exon            170..439
FT                   /gene="HLA_B"
FT                   /allele="HLA-B*3501new"
FT                   /number=2
FT   variation       373
FT                   /allele="HLA-B*3501"
FT                   /replace="a"
FT                   /compare=AJ420239.1
FT   intron          440..684
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*3501new"
FT                   /number=2
FT   exon            685..960
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*3501new"
FT                   /number=3
FT   intron          961..1535
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*3501new"
FT                   /number=3
FT   exon            1536..1811
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*3501new"
FT                   /number=4
FT   intron          1812..1915
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*3501new"
FT                   /number=4
FT   exon            1916..2032
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*3501new"
FT                   /number=5
XX
SQ   Sequence 2229 BP; 421 A; 668 C; 727 G; 413 T; 0 other;
     ctgctctggg gggcagtggc cctgaccgag acctgggccg gtgagtgcgg ggtcgggagg        60
     gaaatggcct ctgtggggag gagcgagggg accgcaggcg ggggcgcagg acctgaggag       120
     ccgcgccggg aggagggtcg ggcgggtctc agcccctcct cgcccccagg ctcccactcc       180
     atgaggtatt tctacaccgc catgtcccgg cccggccgcg gggagccccg cttcatcgca       240
     gtgggctacg tggacgacac ccagttcgtg aggttcgaca gcgacgccgc gagtccgagg       300
     acggagcccc gggcgccatg gatagagcag gaggggccgg agtattggga ccggaacaca       360
     cagatcttca aggccaacac acagacttac cgagagagcc tgcggaacct gcgcggctac       420
     tacaaccaga gcgaggccgg tgagtgaccc cggcccgggg cgcaggtcac gactccccat       480
     cccccacgta cggcccgggt cgccccgagt ctccgggtcc gagatccgcc tccctgaggc       540
     cgcgggaccc gcccagaccc tcgaccggcg agagccccag gcgcgtttac ccggtttcat       600
     tttcagttga ggccaaaatc cccgcgggtt ggtcggggcg gggcggggct cgggggacgg       660
     ggctgaccgc ggggccgggg ccagggtctc acatcatcca gaggatgtat ggctgcgacc       720
     tggggcccga cgggcgcctc ctccgcgggc atgaccagtc cgcctacgac ggcaaggatt       780
     acatcgccct gaacgaggac ctgagctcct ggaccgcggc ggacaccgcg gctcagatca       840
     cccagcgcaa gtgggaggcg gcccgtgtgg cggagcagct gagagcctac ctggagggcc       900
     tgtgcgtgga gtggctccgc agatacctgg agaacgggaa ggagacgctg cagcgcgcgg       960
     gtaccagggg cagtggggag ccttccccat ctcctatagg tcgccgggga tggcctccca      1020
     cgagaagagg aggaaaatgg gatcagcgct agaatgtcgc cctcccttga atggagaatg      1080
     gcatgagttt tcctgagttt cctctgaggg ccccctcttc tctctaggac aattaaggga      1140
     tgacgtctct gaggaaatgg aggggaagac agtccctaga atactgatca ggggtcccct      1200
     ttgacccctg cagcagcctt gggaaccgtg acttttcctc tcaggccttg ttctctgcct      1260
     cacactcagt gtgtttgggg ctctgattcc agcacttctg agtcacttta cctccactca      1320
     gatcaggagc agaagtccct gttccccgct cagagactcg aactttccaa tgaataggag      1380
     attatcccag gtgcctgcgt ccaggctggt gtctgggttc tgtgcccctt ccccacacca      1440
     ggtgtcctgt ccattctcag gctggtcaca tgggtggtcc tagggtgtcc catgagagat      1500
     gcaaagcgcc tgaattttct gactcttccc atcagacccc ccaaagacac acgtgaccca      1560
     ccaccccgtc tctgaccatg aggccaccct gaggtgctgg gccctgggct tctaccctgc      1620
     ggagatcaca ctgacctggc agcgggatgg cgaggaccaa actcaggaca ctgagcttgt      1680
     ggagaccaga ccagcaggag atagaacctt ccagaagtgg gcagctgtgg tggtgccttc      1740
     tggagaagag cagagataca catgccatgt acagcatgag gggctgccga agcccctcac      1800
     cctgagatgg ggtaaggagg gggatgaggg gtcatatctc ttctcaggga aagcaggagc      1860
     ccttctggag cccttcagca gggtcagggc ccctcgtctt cccctccttt cccagagcca      1920
     tcttcccagt ccaccatccc catcgtgggc attgttgctg gcctggctgt cctagcagtt      1980
     gtggtcatcg gagctgtggt cgctactgtg atgtgtagga ggaagagctc aggtagggaa      2040
     ggggtgaggg gtggggtctg ggttttcttg tcccactggg ggtttcaagc cccaggtaga      2100
     agtgttccct gcctcattac tgggaagcag catccacaca ggggctaacg cagcctggga      2160
     ccctgtgtgc cagcacttac tcttttgtgc agcacatgtg acaatgaagg acggatgtat      2220
     caccttgat                                                              2229
//


spacer
spacer