spacer

EBI Dbfetch

ID   AM747470; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   AM747470;
XX
DT   18-AUG-2007 (Rel. 92, Created)
DT   01-NOV-2008 (Rel. 97, Last updated, Version 3)
XX
DE   Homo sapiens partial HLA-DRB3 gene for MHC class II antigen, HLA-DRB3*02new
DE   allele, exon 2
XX
KW   HLA-DRB3 gene; HLA-DRB3*02new allele; major histocompatibility complex;
KW   MHC class II antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Danzer M.;
RT   ;
RL   Submitted (18-JUN-2007) to the INSDC.
RL   Danzer M., Genomics, Red Cross Transfusion Service, Krankenhausstrasse 7,
RL   A-4017, AUSTRIA.
XX
RN   [2]
RX   DOI; 10.1111/j.1399-0039.2008.01124.x.
RX   PUBMED; 18764810.
RA   Danzer M., Polin H., Hofer K., Proll J., Gabriel C.;
RT   "Characterisation of two novel HLA alleles, HLA-Cw*0429 and HLA-DRB3*0223";
RL   Tissue Antigens 72(5):498-499(2008).
XX
DR   MD5; 31c88b875ac1c2160c498512b22aecbc.
DR   Ensembl-Gn; ENSG00000196101; homo_sapiens.
DR   Ensembl-Gn; ENSG00000231679; homo_sapiens.
DR   Ensembl-Tr; ENST00000307137; homo_sapiens.
DR   Ensembl-Tr; ENST00000383126; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /tissue_type="peripheral blood"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DRB3"
FT                   /allele="HLA-DRB3*02new"
FT                   /product="MHC class II antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:P79483"
FT                   /db_xref="HGNC:HGNC:4951"
FT                   /db_xref="IMGT/HLA:DRB3*02:23"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="PDB:2Q6W"
FT                   /db_xref="PDB:3C5J"
FT                   /db_xref="PDB:4H1L"
FT                   /db_xref="UniProtKB/Swiss-Prot:P79483"
FT                   /protein_id="CAO00528.1"
FT                   /translation="RFLELLKSECHFFNGTERVRFLERHFHNQEEYARFDSDVGEYRAV
FT                   RELGLPDAEYWNSQKDLLEQKRGQVDNYCRHNYGVGESFTVQRR"
FT   exon            1..270
FT                   /gene="HLA-DRB3"
FT                   /allele="HLA-DRB3*02new"
FT                   /number=2
XX
SQ   Sequence 270 BP; 59 A; 62 C; 99 G; 50 T; 0 other;
     cacgtttctt ggagctgctt aagtctgagt gtcatttctt caatgggacg gagcgggtgc        60
     ggttcctgga gagacacttc cataaccagg aggagtacgc gcgcttcgac agcgacgtgg       120
     gggagtaccg ggcggtgagg gagctggggc tgcctgatgc cgagtactgg aacagccaga       180
     aggacctcct ggagcagaag cggggccagg tggacaatta ctgcagacac aactacgggg       240
     ttggtgagag cttcacagtg cagcggcgag                                        270
//


spacer
spacer