spacer

EBI Dbfetch

ID   AM747469; SV 1; linear; genomic DNA; STD; HUM; 792 BP.
XX
AC   AM747469;
XX
DT   18-AUG-2007 (Rel. 92, Created)
DT   01-NOV-2008 (Rel. 97, Last updated, Version 3)
XX
DE   Homo sapiens partial HLA-C gene for MHC class I antigen, HLA-Cw*04new
DE   allele, exons 2-3
XX
KW   HLA-C gene; HLA-Cw*04new allele; major histocompatibility complex;
KW   MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-792
RA   Danzer M.;
RT   ;
RL   Submitted (18-JUN-2007) to the INSDC.
RL   Danzer M., Genomics, Red Cross Transfusion Service, Krankenhausstrasse 7,
RL   A-4017, AUSTRIA.
XX
RN   [2]
RX   DOI; 10.1111/j.1399-0039.2008.01124.x.
RX   PUBMED; 18764810.
RA   Danzer M., Polin H., Hofer K., Proll J., Gabriel C.;
RT   "Characterisation of two novel HLA alleles, HLA-Cw*0429 and HLA-DRB3*0223";
RL   Tissue Antigens 72(5):498-499(2008).
XX
DR   MD5; 1da06687d7ccced0f2d9806d967fa429.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..792
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /tissue_type="peripheral blood"
FT                   /db_xref="taxon:9606"
FT   CDS             join(<1..270,517..>792)
FT                   /codon_start=3
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*04new"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:A7MA45"
FT                   /db_xref="IMGT/HLA:C*04:29"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:A7MA45"
FT                   /protein_id="CAO00527.1"
FT                   /translation="SHSMRYFSTSVSWPGRGEPRFIAVGYVDDTQFVRFDSDAASPRGE
FT                   PREPWVEQEGPEYWDRETQKYKRQAQADRVSLRNLRGYYNQSEDGSHTLQRMFGCDLGP
FT                   DGRLLRGYNQFAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAAREAEQRRAYLEGTC
FT                   VEWLRRYLENGKETLQRA"
FT   exon            <1..270
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*04new"
FT                   /number=2
FT   intron          271..516
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*04new"
FT                   /number=2
FT   exon            517..792
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*04new"
FT                   /number=3
XX
SQ   Sequence 792 BP; 142 A; 259 C; 284 G; 107 T; 0 other;
     gctcccactc catgaggtat ttctccacat ccgtgtcctg gcccggccgc ggggagcccc        60
     gcttcatcgc agtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagtccaag aggggagccg cgggagccgt gggtggagca ggaggggccg gagtattggg       180
     accgggagac acagaagtac aagcgccagg cacaggctga ccgagtgagc ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggacg gtgagtgacc ccggcccggg gcgcaggtca       300
     cgacccctcc ccatccccca cggacggccc gggtcgcccc gagtctcccc gtctgagatc       360
     caccccgagg ctgcggaacc cgcccagacc ctcgaccgga gagagcccca gtcaccttta       420
     cccggtttca ttttcagttt aggccaaaat ccccgcgggt tggtcgggac tggggcgggg       480
     ctcgggggac cgggctgacc acgggggcgg ggccagggtc tcacaccctc cagaggatgt       540
     ttggctgcga cctggggccg gacgggcgcc tcctccgcgg gtataaccag ttcgcctacg       600
     acggcaagga ttacatcgcc ctgaacgagg atctgcgctc ctggaccgcc gcggacacgg       660
     cggctcagat cacccagcgc aagtgggagg cggcccgtga ggcggagcag cggagagcct       720
     acctggaggg cacgtgcgtg gagtggctcc gcagatacct ggagaacggg aaggagacgc       780
     tgcagcgcgc gg                                                           792
//


spacer
spacer