spacer

EBI Dbfetch

ID   AM746506; SV 1; linear; genomic DNA; STD; HUM; 1195 BP.
XX
AC   AM746506;
XX
DT   11-JUN-2007 (Rel. 92, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 2)
XX
DE   Homo sapiens partial HLA-B gene for MHC class I antigen, HLA-B*3931 allele,
DE   exons 1-4
XX
KW   HLA-B gene; HLA-B*3931 allele; human leucocyte antigen B;
KW   major histocompatibility complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1195
RA   Anholts J.D.H.;
RT   ;
RL   Submitted (07-JUN-2007) to the INSDC.
RL   Anholts J.D.H., Immunohematology And Blood Transfusion, Leiden University
RL   Medical Center, Albinusdreef 2, 2333 ZA, NETHERLANDS.
XX
RN   [2]
RA   Anholtst J.D.H.;
RT   "18 new sequences found during routine SBT typing";
RL   Unpublished.
XX
DR   MD5; 2f57a97ba66a6c76688c6e3a78f5b2f9.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1195
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /cell_type="lymphocyte"
FT                   /tissue_type="blood"
FT                   /db_xref="taxon:9606"
FT   mRNA            join(<1..73,174..443,544..819,920..>1195)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*3931"
FT   CDS             join(<1..73,174..443,544..819,920..>1195)
FT                   /codon_start=1
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*3931"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:A5PHT8"
FT                   /db_xref="IMGT/HLA:B*39:31"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:A5PHT8"
FT                   /protein_id="CAN89606.1"
FT                   /translation="MLVMAPRTILLLLSAALALTETWAGSHSMRYFHTSVSRPGRGEPR
FT                   FISVGYVDDTQFVRFDSDAASPREEPRAPWIEQEGPEYWDRNTQICKTNTQTDRESLRN
FT                   LRGYYNQSEAGSHTLQRMYGCDVGPDGRLLRGHNQFAYDGKDYIALNEDLSSWTAADTA
FT                   AQITQRKWEAARVAEQLRTYLEGTCVEWLRRYLENGKETLQRADPPKTHVTHHPISDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRW"
FT   exon            <1..73
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*3931"
FT                   /number=1
FT   gap             74..173
FT                   /estimated_length=unknown
FT   exon            174..443
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*3931"
FT                   /number=2
FT   gap             444..543
FT                   /estimated_length=unknown
FT   exon            544..819
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*3931"
FT                   /number=3
FT   gap             820..919
FT                   /estimated_length=unknown
FT   exon            920..1195
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*3931"
FT                   /number=4
XX
SQ   Sequence 1195 BP; 191 A; 287 C; 293 G; 124 T; 300 other;
     atgctggtca tggcaccccg aaccatcctc ctgctgctct cggcggccct ggccctgacc        60
     gagacctggg ccgnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       120
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnngctccca       180
     ctccatgagg tatttccaca cctccgtgtc ccggcccggc cgcggggagc cccgcttcat       240
     ctcagtgggc tacgtggacg acacgcagtt cgtgaggttc gacagcgacg ccgcgagtcc       300
     gagagaggag ccgcgggcgc cgtggataga gcaggagggg ccggaatatt gggaccggaa       360
     cacacagatc tgcaagacca acacacagac tgaccgagag agcctgcgga acctgcgcgg       420
     ctactacaac cagagcgagg ccgnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       480
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       540
     nnnggtctca caccctccag aggatgtacg gctgcgacgt ggggccggac gggcgcctcc       600
     tccgcgggca taaccagttc gcctacgacg gcaaggatta catcgccctg aacgaggacc       660
     tgagctcctg gaccgcggcg gacaccgcgg ctcagatcac ccagcgcaag tgggaggcgg       720
     cccgtgtggc ggagcagctg agaacctacc tggagggcac gtgcgtggag tggctccgca       780
     gatacctgga gaacgggaag gagacgctgc agcgcgcggn nnnnnnnnnn nnnnnnnnnn       840
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       900
     nnnnnnnnnn nnnnnnnnna ccccccaaag acacatgtga cccaccaccc catctctgac       960
     catgaggcca ccctgaggtg ctgggccctg ggcttctacc ctgcggagat cacactgacc      1020
     tggcagcggg atggcgagga ccaaactcag gacaccgagc ttgtggagac cagaccagca      1080
     ggagacagaa ccttccagaa gtgggcagct gtggtggtgc cttctggaga agagcagaga      1140
     tacacatgcc atgtacagca tgaggggctg ccgaagcccc tcaccctgag atggg           1195
//


spacer
spacer