spacer

EBI Dbfetch

ID   AM746340; SV 1; linear; genomic DNA; STD; HUM; 1195 BP.
XX
AC   AM746340;
XX
DT   08-JUN-2007 (Rel. 92, Created)
DT   27-OCT-2009 (Rel. 102, Last updated, Version 3)
XX
DE   Homo sapiens partial HLA gene for MHC class I antigen, HLA-Cw*0309new
DE   allele, exons 1-4
XX
KW   HLA-Cw gene; HLA-Cw*0309new allele; human leucocyte antigen Cw;
KW   major histocompatibility complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1195
RA   Anholts J.D.H.;
RT   ;
RL   Submitted (06-JUN-2007) to the INSDC.
RL   Anholts J.D.H., Immunohematology And Blood Transfusion, Leiden University
RL   Medical Center, Albinusdreef 2, 2333 ZA, NETHERLANDS.
XX
RN   [2]
RX   DOI; 10.1111/j.1399-0039.2009.01334.x.
RX   PUBMED; 19744147.
RA   Anholts J.D., Aneq M., Dirks H.L., Tas A., Verduyn W., Oudshoorn M.;
RT   "Thirty-six novel HLA alleles: 7 HLA-A, 11 HLA-B, 15 HLA-C and 3 HLA-DRB1";
RL   Tissue Antigens 74(5):424-428(2009).
XX
DR   MD5; 3e79fd4325deefdd17bd5b2ec6b68760.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1195
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /cell_type="lymphocyte"
FT                   /tissue_type="blood"
FT                   /db_xref="taxon:9606"
FT   mRNA            join(<1..73,174..443,544..819,920..>1195)
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*0309new"
FT   CDS             join(1..73,174..443,544..819,920..>1195)
FT                   /codon_start=1
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*0309new"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:A5PHP8"
FT                   /db_xref="IMGT/HLA:C*03:42"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:A5PHP8"
FT                   /protein_id="CAN89178.1"
FT                   /translation="MRVMAPRTLILLLSGALALTETWAGSHSMRYFYTAVSRPGRGEPH
FT                   FIAVGYVDDTQFVRFDSDAASPRGEPRAPWVEQEGPEYWDRETQKYKRQAQTDRVSLRN
FT                   LRGYYNQSEAGSHIIQRMYGCDLGPDGRLLRGYDQSAYDGKDYIALNEDLRSWTAADTA
FT                   AQITQRKWEAAREAEQLRAYLEGLCVEWLRRYLKNGKETLQRAEHPKTHVTHHPVSDHE
FT                   ATLRCWALGFYPAEITLTWQWDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPEPLTLRW"
FT   exon            <1..73
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*0309new"
FT                   /number=1
FT   gap             74..173
FT                   /estimated_length=unknown
FT   exon            174..443
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*0309new"
FT                   /number=2
FT   gap             444..543
FT                   /estimated_length=unknown
FT   exon            544..819
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*0309new"
FT                   /number=3
FT   gap             820..919
FT                   /estimated_length=unknown
FT   exon            920..1195
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*0309new"
FT                   /number=4
XX
SQ   Sequence 1195 BP; 179 A; 276 C; 311 G; 129 T; 300 other;
     atgcgggtca tggcgccccg aaccctcatc ctgctgctct cgggagccct ggccctgacc        60
     gagacctggg ccgnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       120
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnngctccca       180
     ctccatgagg tatttctaca ccgctgtgtc ccggcccggc cgcggggagc cccacttcat       240
     cgcagtgggc tacgtggacg acacgcagtt cgtgcggttc gacagcgacg ccgcgagtcc       300
     gagaggggag ccgcgggcgc cgtgggtgga gcaggagggg ccggagtatt gggaccggga       360
     gacacagaag tacaagcgcc aggcacagac tgaccgagtg agcctgcgga acctgcgcgg       420
     ctactacaac cagagcgagg ccgnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       480
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       540
     nnnggtctca catcatccag aggatgtatg gctgcgacct ggggcccgac gggcgcctcc       600
     tccgcgggta tgaccagtcc gcctacgacg gcaaggatta catcgccctg aacgaggatc       660
     tgcgctcctg gaccgccgcg gacacggcgg ctcagatcac ccagcgcaag tgggaggcgg       720
     cccgtgaggc ggagcagctg agagcctacc tggagggcct gtgcgtggag tggctccgca       780
     gatacctgaa gaatgggaag gagacgctgc agcgcgcggn nnnnnnnnnn nnnnnnnnnn       840
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       900
     nnnnnnnnnn nnnnnnnnna acacccaaag acacacgtga cccaccatcc cgtctctgac       960
     catgaggcca ccctgaggtg ctgggccctg ggcttctacc ctgcggagat cacactgacc      1020
     tggcagtggg atggggagga ccaaactcag gacactgagc ttgtggagac caggccagca      1080
     ggagatggaa ccttccagaa gtgggcagct gtggtggtgc cttctggaga agagcagaga      1140
     tacacgtgcc atgtgcagca cgaggggctg ccggagcccc tcaccctgag atggg           1195
//


spacer
spacer