spacer

EBI Dbfetch

ID   AM746211; SV 1; linear; genomic DNA; STD; HUM; 646 BP.
XX
AC   AM746211;
XX
DT   07-JUN-2007 (Rel. 92, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 3)
XX
DE   Homo sapiens partial HLA-B gene for human leukocyte antigen, exons 2-3
XX
KW   HLA-B gene; HLA-B*44new alleley; human leukocyte antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-646
RA   Tran H.;
RT   ;
RL   Submitted (06-JUN-2007) to the INSDC.
RL   Tran H., Transplantation Immunology, University of Heidelberg, Im
RL   Neuenheimer Feld 305, Heidelberg 69120, GERMANY.
XX
RN   [2]
RX   DOI; 10.1111/j.1399-0039.2008.01100.x.
RX   PUBMED; 18647362.
RA   Heinold A., Schaller-Suefling E., Opelz G., Scherer S., Tran T.H.;
RT   "Identification of two novel HLA alleles, HLA-A*02010103 and HLA-B*4455,
RT   and characterization of the complete genomic sequence of HLA-A*290201";
RL   Tissue Antigens 72(4):397-400(2008).
XX
DR   MD5; 70c263cf3f2a92456085e769335548cb.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..646
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /country="Germany"
FT                   /sex="male"
FT                   /cell_type="leukocytes"
FT                   /tissue_type="peripheral blood"
FT                   /db_xref="taxon:9606"
FT   mRNA            join(1..270,371..646)
FT                   /gene="HLA-B"
FT                   /allele="B*44new"
FT   CDS             join(<1..270,371..>646)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="B*44new"
FT                   /product="human leukocyte antigen"
FT                   /function="antigen presentation"
FT                   /db_xref="GOA:A5PHK0"
FT                   /db_xref="IMGT/HLA:B*44:55"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:A5PHK0"
FT                   /protein_id="CAN88920.1"
FT                   /translation="SHSMRYFHTAMSRPGRGEPRFITVGYVDDTLFVRFDSDATSPRKE
FT                   PRAPWIEQEGPEYWDRETQISKTNTQTYRENLRTALRYYNQSEAGSHIIQRMYGCDVGP
FT                   DGRLLRGYDQDAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQDRAYLEGLC
FT                   VESLRRYLENGKETLQRA"
FT   exon            1..270
FT                   /gene="HLA-B"
FT                   /allele="B*44new"
FT                   /number=2
FT   gap             271..370
FT                   /estimated_length=unknown
FT   exon            371..646
FT                   /gene="HLA-B"
FT                   /allele="B*44new"
FT                   /number=3
XX
SQ   Sequence 646 BP; 114 A; 174 C; 188 G; 70 T; 100 other;
     gctcccactc catgaggtat ttccacaccg ccatgtcccg gcccggccgc ggggagcccc        60
     gcttcatcac cgtgggctac gtggacgaca cgctgttcgt gaggttcgac agcgacgcca       120
     cgagtccgag gaaggagccg cgggcgccat ggatagagca ggaggggccg gagtattggg       180
     accgggagac acagatctcc aagaccaaca cacagactta ccgagagaac ctgcgcaccg       240
     cgctccgcta ctacaaccag agcgaggccg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn ggtctcacat catccagagg atgtacggct gcgacgtggg gccggacggg       420
     cgcctcctcc gcgggtatga ccaggacgcc tacgacggca aggattacat cgccctgaac       480
     gaggacctga gctcctggac cgcggcggac accgcggctc agatcaccca gcgcaagtgg       540
     gaggcggccc gtgtggcgga gcaggacaga gcctacctgg agggcctgtg cgtggagtcg       600
     ctccgcagat acctggagaa cgggaaggag acgctgcagc gcgcgg                      646
//


spacer
spacer