Dbfetch

ID   AM712907; SV 1; linear; genomic DNA; STD; HUM; 2057 BP.
XX
AC   AM712907;
XX
DT   25-MAY-2007 (Rel. 91, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 2)
XX
DE   Homo sapiens partial HLA-A gene for MHC class I antigen, HLA-A*02new
DE   allele, exons 1-5
XX
KW   HLA-A gene; HLA-A*02new allele; human leucocyte antigen A;
KW   major histocompatibility complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-2057
RA   Dormoy A.;
RT   ;
RL   Submitted (21-MAY-2007) to the INSDC.
RL   Dormoy A., Laboratoire HLA, Etablissement Francais du Sang - Alsace, 10 rue
RL   Spielmann, 67000, FRANCE.
XX
RN   [2]
RA   Dormoy A., Leisenbach R.;
RT   "The new HLA-A*02 allele has 2 silent nucleotides changes from A*02010101
RT   allele at positions 240 where T->G(codon 56(GGT(Gly)->GGG(Gly))and 477
RT   where A->C (codon 136 GCA(Ala)->GCG(Ala))";
RL   Unpublished.
XX
DR   MD5; 1c6735d3d98484d63541315282dfabca.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2057
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /PCR_primers="fwd_name: P5' Ala T-9, fwd_seq:
FT                   ctgctactctcgggggct, rev_name: P3' intron 6A, rev_seq:
FT                   cccacagaasatgtggctag"
FT                   /db_xref="taxon:9606"
FT   CDS             join(<1..26,157..426,669..944,1545..1820,1920..>2057)
FT                   /codon_start=2
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02new"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:A5I8L1"
FT                   /db_xref="IMGT/HLA:A*02:01:17"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:A5I8L1"
FT                   /protein_id="CAN85194.1"
FT                   /translation="LALTQTWAGSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFD
FT                   SDAASQRMEPRAPWIEQEGPEYWDGETRKVKAHSQTHRVDLGTLRGYYNQSEAGSHTVQ
FT                   RMYGCDVGSDWRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQTTKHKWEAAHVAEQ
FT                   LRAYLEGTCVEWLRRYLENGKETLQRTDAPKTHMTHHAVSDHEATLRCWALSFYPAEIT
FT                   LTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGQEQRYTCHVQHEGLPKPLTLR
FT                   WEPSSQPTIPIVGIIAGLVLFGAVITGAVVAAVMWRRKSSGGEGVKG"
FT   exon            <1..26
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02new"
FT                   /number=1
FT   intron          27..156
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02new"
FT                   /number=1
FT   exon            157..426
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02new"
FT                   /number=2
FT   variation       323
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02010101"
FT                   /replace="t"
FT                   /compare=AJ555412.1
FT                   /note="silent"
FT   intron          427..668
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02new"
FT                   /number=2
FT   exon            669..944
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02new"
FT                   /number=3
FT   variation       802
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02010101"
FT                   /replace="g"
FT                   /compare=AJ555412.1
FT                   /note="silent"
FT   intron          945..1544
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02new"
FT                   /number=3
FT   exon            1545..1820
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02new"
FT                   /number=4
FT   intron          1821..1919
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02new"
FT                   /number=4
FT   exon            1920..>2057
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02new"
FT                   /number=5
XX
SQ   Sequence 2057 BP; 392 A; 611 C; 676 G; 378 T; 0 other;
     tctggccctg acccagacct gggcgggtga gtgcggggtc gggagggaaa cggcctctgt        60
     ggggagaagc aacgggcccg cctggcgggg gcgcaggacc cgggaagccg cgccgggagg       120
     agggtcgggc gggtctcagc cactcctcgt ccccaggctc tcactccatg aggtatttct       180
     tcacatccgt gtcccggccc ggccgcgggg agccccgctt catcgcagtg ggctacgtgg       240
     acgacacgca gttcgtgcgg ttcgacagcg acgccgcgag ccagaggatg gagccgcggg       300
     cgccgtggat agagcaggag gggccggagt attgggacgg ggagacacgg aaagtgaagg       360
     cccactcaca gactcaccga gtggacctgg ggaccctgcg cggctactac aaccagagcg       420
     aggccggtga gtgaccccgg cccggggcgc aggtcacgac ctctcatccc ccacggacgg       480
     gccaggtcgc ccacagtctc cgggtccgag atccgccccg aagccgcggg accccgagac       540
     ccttgccccg ggagaggccc aggcgccttt acccggtttc attttcagtt taggccaaaa       600
     atccccccag gttggtcggg gcgggggcgg ggctcggggg accgggctga ccgcggggtc       660
     cgggccaggt tctcacaccg tccagaggat gtatggctgc gacgtggggt cggactggcg       720
     cttcctccgc gggtaccacc agtacgccta cgacggcaag gattacatcg ccctgaaaga       780
     ggacctgcgc tcttggaccg cagcggacat ggcagctcag accaccaagc acaagtggga       840
     ggcggcccat gtggcggagc agttgagagc ctacctggag ggcacgtgcg tggagtggct       900
     ccgcagatac ctggagaacg ggaaggagac gctgcagcgc acgggtacca ggggccacgg       960
     ggcgcctccc tgatcgcctg tagatctccc gggctggcct cccacaagga ggggagacaa      1020
     ttgggaccaa cactagaata tcgccctccc tctggtcctg agggagagga atcctcctgg      1080
     gtttccagat cctgtaccag agagtgactc tgaggttccg ccctgctctc tgacacaatt      1140
     aagggataaa atctctgaag gaatgacggg aagacgatcc ctcgaatact gatgagtggt      1200
     tccctttgac acacacaggc agcagccttg ggcccgtgac ttttcctctc aggccttgtt      1260
     ctctgcttca cactcaatgt gtgtgggggt ctgagtccag cacttctgag tccttcagcc      1320
     tccactcagg tcaggaccag aagtcgctgt tccctcttca gggactagaa ttttccacgg      1380
     aataggagat tatcccaggt gcctgtgtcc aggctggtgt ctgggttctg tgctcccttc      1440
     cccatcccag gtgtcctgtc cattctcaag atagccacat gtgtgctgga ggagtgtccc      1500
     atgacagatg caaaatgcct gaatgatctg actcttcctg acagacgccc ccaaaacgca      1560
     tatgactcac cacgctgtct ctgaccatga agccaccctg aggtgctggg ccctgagctt      1620
     ctaccctgcg gagatcacac tgacctggca gcgggatggg gaggaccaga cccaggacac      1680
     ggagctcgtg gagaccaggc ctgcagggga tggaaccttc cagaagtggg cggctgtggt      1740
     ggtgccttct ggacaggagc agagatacac ctgccatgtg cagcatgagg gtttgcccaa      1800
     gcccctcacc ctgagatggg gtaaggaggg agacgggggt gtcatgtctt ttagggaaag      1860
     caggagcctc tctgaccttt agcagggtca gggcccctca ccttcccctc ttttcccaga      1920
     gccgtcttcc cagcccacca tccccatcgt gggcatcatt gctggcctgg ttctctttgg      1980
     agctgtgatc actggagctg tggtcgctgc tgtgatgtgg aggaggaaga gctcaggtgg      2040
     ggaaggggtg aagggtg                                                     2057
//