Dbfetch

ID   AM711559; SV 1; linear; genomic DNA; STD; HUM; 1021 BP.
XX
AC   AM711559;
XX
DT   11-MAY-2007 (Rel. 91, Created)
DT   27-OCT-2009 (Rel. 102, Last updated, Version 3)
XX
DE   Homo sapiens partial HLA-A gene for truncated MHC class I antigen,
DE   HLA-A*02new allele, exons 2-4
XX
KW   HLA-A gene; HLA-A*02new allele; major histocompatibility complex;
KW   MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1021
RA   Anholts J.D.H.;
RT   ;
RL   Submitted (10-MAY-2007) to the INSDC.
RL   Anholts J.D.H., Immunohematology and Bloodtransfusion, Leiden University
RL   Medical Center, Albinusdreef 2, 2333 ZA, NETHERLANDS.
XX
RN   [2]
RX   DOI; 10.1111/j.1399-0039.2009.01334.x.
RX   PUBMED; 19744147.
RA   Anholts J.D., Aneq M., Dirks H.L., Tas A., Verduyn W., Oudshoorn M.;
RT   "Thirty-six novel HLA alleles: 7 HLA-A, 11 HLA-B, 15 HLA-C and 3 HLA-DRB1";
RL   Tissue Antigens 74(5):424-428(2009).
XX
DR   MD5; 2aa7f1137321be2c4a7ac28a95155b2b.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1021
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /cell_type="lymphocyte"
FT                   /tissue_type="blood"
FT                   /db_xref="taxon:9606"
FT   exon            1..>269
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02new"
FT                   /number=2
FT   CDS             <1..200
FT                   /codon_start=3
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02new"
FT                   /product="truncated MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:A5CLH5"
FT                   /db_xref="IMGT/HLA:A*02:125N"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="UniProtKB/TrEMBL:A5CLH5"
FT                   /protein_id="CAM98059.1"
FT                   /translation="SHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRME
FT                   PRAPWIEQEGPEYWDGEHGK"
FT   gap             270..369
FT                   /estimated_length=unknown
FT   exon            370..645
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02new"
FT                   /number=3
FT   gap             646..745
FT                   /estimated_length=unknown
FT   exon            746..>1021
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02new"
FT                   /number=4
XX
SQ   Sequence 1021 BP; 171 A; 244 C; 281 G; 125 T; 200 other;
     gctctcactc catgaggtat ttcttcacat ccgtgtcccg gcccggccgc ggggagcccc        60
     gcttcatcgc agtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagccagag gatggagccg cgggcgccgt ggatagagca ggagggtccg gagtattggg       180
     acggggaaca cggaaagtga aggcccactc acagactcac cgagtggacc tggggaccct       240
     gcgcggctac tacaaccaga gcgaggccgn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnng ttctcacacc gtccagagga tgtatggctg cgacgtgggg tcggactggc       420
     gcttcctccg cgggtaccac cagtacgcct acgacggcaa ggattacatc gccctgaaag       480
     aggacctgcg ctcttggacc gcggcggaca tggcagctca gaccaccaag cacaagtggg       540
     aggcggccca tgtggcggag cagttgagag cctacctgga gggcacgtgc gtggagtggc       600
     tccgcagata cctggagaac gggaaggaga cgctgcagcg cacggnnnnn nnnnnnnnnn       660
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       720
     nnnnnnnnnn nnnnnnnnnn nnnnnacgcc cccaaaacgc atatgactca ccacgctgtc       780
     tctgaccatg aagccaccct gaggtgctgg gccctgagct tctaccctgc ggagatcaca       840
     ctgacctggc agcgggatgg ggaggaccag acccaggaca cggagctcgt ggagaccagg       900
     cctgcagggg atggaacctt ccagaagtgg gcggctgtgg tggtgccttc tggacaggag       960
     cagagataca cctgccatgt gcagcatgag ggtttgccca agcccctcac cctgagatgg      1020
     g                                                                      1021
//