spacer

EBI Dbfetch

ID   AM698036; SV 1; linear; genomic DNA; STD; HUM; 267 BP.
XX
AC   AM698036;
XX
DT   23-MAY-2007 (Rel. 91, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 2)
XX
DE   Homo sapiens partial DPB1 gene for MHC class II antigen, HLA-DPB1*0101v
DE   allele, exon 2
XX
KW   HLA-DPB1 gene; HLA-DPB1*0101v allele; human leucocyte antigen D;
KW   major histocompatibility complex; MHC class II antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-267
RA   Casanova A.A.;
RT   ;
RL   Submitted (23-APR-2007) to the INSDC.
RL   Casanova A.A., Dept. HLA Sequencing, Anthony Nolan Trust, Royal Free
RL   Hospital, Hampstead, London, NW3 2QG, UNITED KINGDOM.
XX
RN   [2]
RA   Casanova A.A.;
RT   "Sequence of DPB1*0101 variant";
RL   Unpublished.
XX
DR   MD5; ead6b268bd84bde627aa74ec40f40a90.
DR   Ensembl-Gn; ENSG00000215048; homo_sapiens.
DR   Ensembl-Gn; ENSG00000223865; homo_sapiens.
DR   Ensembl-Gn; ENSG00000226826; homo_sapiens.
DR   Ensembl-Gn; ENSG00000230763; homo_sapiens.
DR   Ensembl-Gn; ENSG00000236693; homo_sapiens.
DR   Ensembl-Gn; ENSG00000237710; homo_sapiens.
DR   Ensembl-Tr; ENST00000399500; homo_sapiens.
DR   Ensembl-Tr; ENST00000411749; homo_sapiens.
DR   Ensembl-Tr; ENST00000418931; homo_sapiens.
DR   Ensembl-Tr; ENST00000425130; homo_sapiens.
DR   Ensembl-Tr; ENST00000433800; homo_sapiens.
DR   Ensembl-Tr; ENST00000454006; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..267
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>267
FT                   /codon_start=3
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*0101v"
FT                   /product="MHC class II antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:P04440"
FT                   /db_xref="HGNC:HGNC:4940"
FT                   /db_xref="IMGT/HLA:DPB1*118:01"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="PDB:3LQZ"
FT                   /db_xref="UniProtKB/Swiss-Prot:P04440"
FT                   /protein_id="CAM91695.1"
FT                   /translation="ENYVYQGRQECYAFNGTQRFLERYIYNPEEYARFDSDVGEFRAVT
FT                   ELGRPAAEYWNSQKDILEEKRAVPDRVCRHNYELDEAVTLQRR"
FT   exon            1..267
FT                   /gene="HlA-DPB1"
FT                   /allele="HLA-DPB1*0101v"
FT                   /number=2
XX
SQ   Sequence 267 BP; 64 A; 67 C; 99 G; 37 T; 0 other;
     cagagaatta cgtgtaccag ggacggcagg aatgctacgc gtttaatggg acacagcgct        60
     tcctggagag atacatctac aacccggagg agtacgcgcg cttcgacagc gacgtggggg       120
     agttccgggc ggtgacggag ctggggcggc ctgctgcgga gtactggaac agccagaagg       180
     acatcctgga ggagaagcgg gcagtgccgg acagggtatg cagacacaac tacgagctgg       240
     acgaggccgt gaccctgcag cgccgag                                           267
//


spacer
spacer