spacer

EBI Dbfetch

ID   AM696284; SV 1; linear; genomic DNA; STD; HUM; 2935 BP.
XX
AC   AM696284;
XX
DT   20-APR-2007 (Rel. 91, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 2)
XX
DE   Homo sapiens HLA-Cw gene for MHC class I antigen, HLA-Cw*07new allele,
DE   exons 1-8
XX
KW   HLA-Cw gene; HLA-Cw*07new allele; human leucocyte antigen C;
KW   major histocompatibility complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-2935
RA   Hepkema B.G.;
RT   ;
RL   Submitted (18-APR-2007) to the INSDC.
RL   Hepkema B.G., Transplantation Immunology, University Medical Center
RL   Groningen, P.O. Box 30 001, 9700 RB Groningen, NETHERLANDS.
XX
RN   [2]
RA   Hepkema B.G., Velde vd H., Lems S.P.M.;
RT   "New HLA-Cw*07 allele";
RL   Unpublished.
XX
DR   MD5; 45a4d818fffa2d2428658489af9e98b1.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2935
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             join(7..79,210..479,730..1005,1593..1868,1993..2112,
FT                   2553..2585,2693..2740,2905..2909)
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*07new"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:A4Q9R6"
FT                   /db_xref="IMGT/HLA:C*07:49"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:A4Q9R6"
FT                   /protein_id="CAM90595.1"
FT                   /translation="MRVMAPRALLLLLSGGLALTETWACSHSMRYFDTAVSRPGRGEPR
FT                   FISVGYVDDTQFVRFDSDAASPRGEPRAPWVEQEGPEYWDRETQKYKRQAQADRVNLRN
FT                   LRGYYNQSEDGSHTLQRMSGCDLGPDGRLLRGYDQSAYDGKDYIALNEDLRSWTAADTA
FT                   AQITQRKLEAARAAEQLRAYLEGTCVEWLRRYLENGKETLQRAEPPKTHVTHHPLSDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGQEQRY
FT                   TCHMQHEGLQEPLTLSWEPSSQPTIPIMGIVAGLAVLVVLAVLGAVVTAMMCRRKSSGG
FT                   KGGSCSQAACSNSAQGSDESLITCKA"
FT   exon            <7..79
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*07new"
FT                   /number=1
FT   intron          80..209
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*07new"
FT                   /number=1
FT   exon            210..479
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*07new"
FT                   /number=2
FT   intron          480..729
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*07new"
FT                   /number=2
FT   exon            730..1005
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*07new"
FT                   /number=3
FT   intron          1006..1592
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*07new"
FT                   /number=3
FT   exon            1593..1868
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*07new"
FT                   /number=4
FT   intron          1869..1992
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*07new"
FT                   /number=4
FT   exon            1993..2112
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*07new"
FT                   /number=5
FT   intron          2113..2552
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*07new"
FT                   /number=5
FT   exon            2553..2585
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*07new"
FT                   /number=6
FT   intron          2586..2692
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*07new"
FT                   /number=6
FT   exon            2693..2740
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*07new"
FT                   /number=7
FT   intron          2741..2904
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*07new"
FT                   /number=7
FT   exon            2905..>2909
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*07new"
FT                   /number=8
XX
SQ   Sequence 2935 BP; 547 A; 854 C; 936 G; 598 T; 0 other;
     gccgagatgc gggtcatggc gccccgagcc ctcctcctgc tgctctcggg aggcctggcc        60
     ctgaccgaga cctgggcctg tgagtgcggg gttgggaggg aagcggcctc tgcggagagg       120
     agcgaggggc cctcccggcg agggcgcagg acccggggag ccgcgcaggg aggtgggtcg       180
     ggcgggtctc agcccctcct cgcccccagg ctcccactcc atgaggtatt tcgacaccgc       240
     cgtgtcccgg cccggccgcg gagagccccg cttcatctca gtgggctacg tggacgacac       300
     gcagttcgtg cggttcgaca gcgacgccgc gagtccgaga ggggagccgc gggcgccgtg       360
     ggtggagcag gaggggccgg agtattggga ccgggagaca cagaagtaca agcgccaggc       420
     acaggctgac cgagtgaacc tgcggaacct gcgcggctac tacaaccaga gcgaggacgg       480
     tgagtgaccc cggcccgggg cgcaggtcac gacccctccc catcccccac ggacggcccg       540
     ggtcgcccag agtctccccg tctgagatcc accccaaggt ggatctgcgg aacccgccca       600
     gaccctcgac cggagagagc cccagtcgcc tttacccggt ttcattttcg gtttaggcca       660
     aaatccccgc gggttggtcg gggcggggcg gggctcgggg gactgggctg accgcggggg       720
     cggggccagg gtctcacacc ctccagagga tgtctggctg cgacctgggg cccgacgggc       780
     gcctcctccg cgggtatgac cagtccgcct acgacggcaa ggattacatc gccctgaacg       840
     aggacctgcg ctcctggacc gccgcggaca ccgcggctca gatcacccag cgcaagttgg       900
     aggcggcccg tgcggcggag cagctgagag cctacctgga gggcacgtgc gtggagtggc       960
     tccgcagata cctggagaac gggaaggaga cgctgcagcg cgcaggtacc aggggcagtg      1020
     gggagccttc cccatctcct atagatctcc cgggatggcc tcccacgagg aggggaggaa      1080
     aatgggatca gcactggaat atcgccctcc cttgaatgga gaatggcatg agttttcctg      1140
     agtttcctct gagggccccc tctgctctct aggacaatta agggatgaag tctctgagga      1200
     aatggagggg aagacagtcc ctggaatact gatcaggggt ctcctttgac cactttgacc      1260
     actgcagcag ctgtggtcag gctgctgacc tttctctcag gccttgttct ctgcctcaca      1320
     ctcaatgtgt ctgaaggttt gattccagct tttctgagtc ctgcagcctc cactcaggtc      1380
     aggaccagaa gtcgctgttc ctccctcaga gactagaact ttccaatgaa taggagatta      1440
     tcccaggtgc ctgtgtccag gctggcgtct gggttctctg ccgccttccc caccccaggt      1500
     gtcctgtcca ttctcaggat ggtcacatgg gcgctgctgg agtgtcccaa gagagatgca      1560
     aagtgtctga attttctgac tcttcccgtc agaaccccca aagacacacg tgacccacca      1620
     ccccctctct gaccatgagg ccaccctgag gtgctgggcc ctgggcttct accctgcgga      1680
     gatcacactg acctggcagc gggatgggga ggaccagacc caggacaccg agcttgtgga      1740
     gaccaggcca gcaggagatg gaaccttcca gaagtgggca gctgtggtgg tgccttctgg      1800
     acaagagcag agatacacgt gccatatgca gcacgagggg ctgcaagagc ccctcaccct      1860
     gagctggggt aaggagggga atggggggtc acatctctta tcagagaaag cagaagtcct      1920
     tctggagccc ttcagccggg tcagggctga ggcttggggg tcagggcccc tcaccttctc      1980
     ctcctttccc agagccatct tcccagccca ccatccccat catgggcatc gttgctggcc      2040
     tggctgtcct ggttgtccta gctgtccttg gagctgtggt caccgctatg atgtgtagga      2100
     ggaagagctc aggtagggaa ggggtgaaga gcggggtctg ggttttcttg tcccactggg      2160
     agtttcaagc cccaggtaga agtgtgcccc gccttgttac tggaagcacc atccacacat      2220
     gggccatccc agcctgggac cctgtgtgcc agcacttact cttttgtgaa gcacatgtga      2280
     caatgaagga cggatgtatc accttgatga ttatggtgtt ggggtcctga ttccagcatt      2340
     catgagtcag gggaaggtcc ctgctaagga cagaccttag gagggcagtt ggtccagaac      2400
     ccacaactgc tttccccatg tttcctgatc ctgccctggg tctgcagtcg tagttctgga      2460
     aacttctctt gggtccaaga ctaggaggtt cccctaagat cacatggccc tgcctcctcc      2520
     cagtcccctc atagggcatt ttcttcccac aggtggaaaa ggagggagct gctctcaggc      2580
     tgcgtgtaag tgatggcggc gggcgtgtgg aggagctcac ctactccata attcctcttg      2640
     tcccacatct cctgcgggct ctgaccaggt cttttttttt gttctacccc aggcagcaac      2700
     agtgcccagg gctctgatga gtctctcatc acttgtaaag gtgagattct ggggagctga      2760
     agtggtcggg ggtggggcag agggaaaagg cctgggtaat ggggattctt tgattgggac      2820
     gtttcgagtg tgtggtgggc cgttcagagt gtcatcgctt accatgactg acctgaattt      2880
     gttcatgact attgtgttct gtagcctgag acagctgcct gtgtgggact gagat           2935
//


spacer
spacer