Dbfetch

ID   AM689932; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   AM689932;
XX
DT   06-APR-2007 (Rel. 91, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 2)
XX
DE   Homo sapiens partial HLA-DRB1 gene for MHC class II antigen,
DE   HLA-DRB1*1101new allele, exon 2
XX
KW   HLA-DRB1 gene; HLA-DRB1*1101new allele; human leucocyte antigen DRB1;
KW   major histocompatibility complex; MHC class II antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Tiercy J.M.;
RT   ;
RL   Submitted (02-APR-2007) to the INSDC.
RL   Tiercy J.M., University Hospital Geneva, Transplantation Immunology
RL   Unit/LNRH, 24 rue Micheli-du-Crest, 1211 Geneva 14, SWITZERLAND.
XX
RN   [2]
RA   Rahal M., Villard J., Tiercy J.M.;
RT   "Sequence of a variant DRB1*1101 allele with a silent mutation at codon
RT   48";
RL   Unpublished.
XX
DR   MD5; 4ee53003fe55511fb1404477cd43a300.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*1101new"
FT                   /product="MHC class II antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:A4Q970"
FT                   /db_xref="IMGT/HLA:DRB1*11:01:07"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:A4Q970"
FT                   /protein_id="CAM84026.1"
FT                   /translation="RFLEYSTSECHFFNGTERVRFLDRYFYNQEEYVRFDSDVGEFRAV
FT                   TELGRPDEEYWNSQKDFLEDRRAAVDTYCRHNYGVGESFTVQRR"
FT   exon            1..270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*1101new"
FT                   /number=2
XX
SQ   Sequence 270 BP; 59 A; 62 C; 96 G; 53 T; 0 other;
     cacgtttctt ggagtactct acgtctgagt gtcatttctt caatgggacg gagcgggtgc        60
     ggttcctgga cagatacttc tataaccaag aggagtacgt gcgcttcgac agcgacgtgg       120
     gggagttccg agcggtgacg gagctggggc ggcctgatga ggagtactgg aacagccaga       180
     aggacttcct ggaagacagg cgggccgcgg tggacaccta ctgcagacac aactacgggg       240
     ttggtgagag cttcacagtg cagcggcgag                                        270
//