spacer

EBI Dbfetch

ID   AM495256; SV 1; linear; genomic DNA; STD; HUM; 1867 BP.
XX
AC   AM495256;
XX
DT   21-MAR-2007 (Rel. 91, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 2)
XX
DE   Homo sapiens partial HLA-B gene for MHC Class I antigen, HLA-B*56new
DE   allele, exons 1-4
XX
KW   HLA-B gene; human leucocyte antigen B; major histocompatibility complex;
KW   MHC Class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1867
RA   Aubert V.;
RT   ;
RL   Submitted (28-FEB-2007) to the INSDC.
RL   Aubert V., Service d'immunologie et d'allergie, Centre Hospitalier
RL   Universitaire Vaudois, Rue du Bugnon, 1011 Lausanne, SWITZERLAND.
XX
RN   [2]
RA   Aubert V., Mayerat C., Lopez N., Pantaleo G.;
RT   "Sequence of novel HLA-B*56 allele in an african individual";
RL   Unpublished.
XX
DR   MD5; a703d0e8c6b5db3e08dc9f67254c2118.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1867
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /cell_type="B-lymphocyte"
FT                   /db_xref="taxon:9606"
FT   CDS             join(1..73,204..473,715..990,1592..>1867)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*56new"
FT                   /product="MHC Class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:A4FSH4"
FT                   /db_xref="IMGT/HLA:B*35:76"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:A4FSH4"
FT                   /protein_id="CAM41399.1"
FT                   /translation="MRVTAPRTVLLLLWGAVALTETWAGSHSMRYFYTAMSRPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASPRTEPRAPWIEQEGPEYWDRNTQIYKAQAQTDRESLRN
FT                   LRGYYNQSEAGSHIIQRMYGCDLGPDGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTA
FT                   AQITQRKWEAARVAEQLRAYLEGLCVEWLRRYLENGKETLQRADPPKTHVTHHPVSDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRW"
FT   exon            1..73
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*56new"
FT                   /number=1
FT   intron          74..203
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*56new"
FT                   /number=1
FT   exon            204..473
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*56new"
FT                   /number=2
FT   intron          474..714
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*56new"
FT                   /number=2
FT   exon            715..990
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*56new"
FT                   /number=3
FT   intron          991..1591
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*56new"
FT                   /number=3
FT   exon            1592..1867
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*56new"
FT                   /number=4
XX
SQ   Sequence 1867 BP; 185 A; 285 C; 301 G; 124 T; 972 other;
     atgcgggtca cggcgccccg aaccgtcctc ctgctgctct ggggggcagt ggccctgacc        60
     gagacctggg ccgnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       120
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       180
     nnnnnnnnnn nnnnnnnnnn nnngctccca ctccatgagg tatttctaca ccgccatgtc       240
     ccggcccggc cgcggggagc cccgcttcat cgcagtgggc tacgtggacg acacccagtt       300
     cgtgaggttc gacagcgacg ccgcgagtcc gaggacggag ccccgggcgc catggataga       360
     gcaggagggg ccggagtatt gggaccggaa cacacagatc tacaaggccc aggcacagac       420
     tgaccgagag agcctgcgga acctgcgcgg ctactacaac cagagcgagg ccgnnnnnnn       480
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       540
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       600
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       660
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnggtctc       720
     acatcatcca gaggatgtat ggctgcgacc tggggcccga cgggcgcctc ctccgcgggc       780
     atgaccagtc cgcctacgac ggcaaggatt acatcgccct gaacgaggac ctgagctcct       840
     ggaccgcggc ggacaccgcg gctcagatca cccagcgcaa gtgggaggcg gcccgtgtgg       900
     cggagcagct gagagcctac ctggagggcc tgtgcgtgga gtggctccgc agatacctgg       960
     agaacgggaa ggagacgctg cagcgcgcgg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1020
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1080
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1140
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1200
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1260
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1320
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1380
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1440
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1500
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1560
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn naccccccaa agacacacgt gacccaccac      1620
     cccgtctctg accatgaggc caccctgagg tgctgggccc tgggcttcta ccctgcggag      1680
     atcacactga cctggcagcg ggatggcgag gaccaaactc aggacactga gcttgtggag      1740
     accagaccag caggagatag aaccttccag aagtgggcag ctgtggtggt gccttctgga      1800
     gaagagcaga gatacacatg ccatgtacag catgaggggc tgccgaagcc cctcaccctg      1860
     agatggg                                                                1867
//


spacer
spacer