Dbfetch

ID   AM493690; SV 3; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   AM493690;
XX
DT   06-SEP-2008 (Rel. 97, Created)
DT   06-SEP-2008 (Rel. 97, Last updated, Version 1)
XX
DE   Homo sapiens partial HLA-DRB1 gene for MHC class II antigen, DRB1*030101FK
DE   allele, exon 2
XX
KW   DRB1*030101FK allele; HLA-DRB1 gene; human leucocyte antigen DRB1;
KW   major histocompatibility complex; MHC class II antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RC   revised by author [21-MAR-2007]
RP   1-270
RA   Tavoularis S.;
RT   ;
RL   Submitted (16-FEB-2007) to the INSDC.
RL   Tavoularis S., HLA laboratory, Canadian Blood Services, Head Office, 1800
RL   Alta vista Dr. Ottawa, Ontario K1G 4J5 Canada, CANADA.
XX
RN   [2]
RA   Tavoularis S., Conrod V., Ribeiro E.;
RT   "Identification of three Novel DRB1 alleles";
RL   Hum. Immunol. 68(Supp 1):S63-S63(2007).
XX
DR   MD5; f647da877846950ab50ef84cea9f70fa.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /tissue_type="blood"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /allele="DRB1*030101FK"
FT                   /product="MHC class II antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:B5D5S9"
FT                   /db_xref="IMGT/HLA:DRB1*03:34"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:B5D5S9"
FT                   /protein_id="CAM35456.2"
FT                   /translation="RFLEYSTSECHFFNGTERVRYLDRYFHNQEENVRFDSDVGEFRAV
FT                   TELGRPDAEYWNSQKDLLEQKRGRVNNYCRHNYGVVESFTVQRR"
FT   exon            1..270
FT                   /gene="HLA-DRB1"
FT                   /allele="DRB1*030101FK"
FT                   /number=2
XX
SQ   Sequence 270 BP; 60 A; 64 C; 97 G; 49 T; 0 other;
     cacgtttctt ggagtactct acgtctgagt gtcatttctt caatgggacg gagcgggtgc        60
     ggtacctgga cagatacttc cataaccagg aggagaacgt gcgcttcgac agcgacgtgg       120
     gggagttccg ggcggtgacg gagctggggc ggcctgatgc cgagtactgg aacagccaga       180
     aggacctcct ggagcagaag cggggccggg tgaacaacta ctgcagacac aactacgggg       240
     ttgtggagag cttcacagtg cagcggcgag                                        270
//