Dbfetch

ID   AM493248; SV 2; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   AM493248;
XX
DT   15-FEB-2007 (Rel. 90, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens partial HLA-DRB1 gene for MHC class II antigen, HLA-DRB1*11
DE   variant MVE1206 allele, exon 2
XX
KW   HLA-DRB1 gene; HLA-DRB1*11 variant MVE1206 allele;
KW   major histocompatability complex; MHC class II antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RC   revised by author [02-MAR-2007]
RP   1-270
RA   Blasczyk R.;
RT   ;
RL   Submitted (15-FEB-2007) to the INSDC.
RL   Blasczyk R., Institute for Transfusion Medicine, Hannover Medical School,
RL   Carl-Neuberg-Str. 1, Hannover, 30625, GERMANY.
XX
RN   [2]
RA   Horn P.A., Verboom M., Blasczyk R.;
RT   "A novel HLA-DRB1*11 allele.";
RL   Unpublished.
XX
DR   MD5; d7cd5bdc2d9d1fd63d93b6096d5ea0a4.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /map="6p21.3"
FT                   /isolate="MHHN-267472"
FT                   /mol_type="genomic DNA"
FT                   /identified_by="Peter Horn"
FT                   /tissue_type="peripheral blood"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*11 variant MVE1206"
FT                   /product="MHC class II antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:A2VBX3"
FT                   /db_xref="IMGT/HLA:DRB1*11:62:01"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:A2VBX3"
FT                   /protein_id="CAM34674.2"
FT                   /translation="RFLEYSTSECHFFNGTERVRFLDRYFHNQEEYVRFDSDVGEFRAV
FT                   TELGRPDEEYWNSQKDFLEDRRAAVDTYCRHNYGVGESFTVQRR"
FT   exon            1..270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*11 variant MVE1206"
FT                   /number=2
XX
SQ   Sequence 270 BP; 58 A; 63 C; 97 G; 52 T; 0 other;
     cacgtttctt ggagtactct acgtctgagt gtcatttctt caatgggacg gagcgggtgc        60
     ggttcctgga cagatacttc cataaccaag aggagtacgt gcgcttcgac agcgacgtgg       120
     gggagttccg ggcggtgacg gagctggggc ggcctgatga ggagtactgg aacagccaga       180
     aggacttcct ggaagacagg cgggccgcgg tggacaccta ctgcagacac aactacgggg       240
     ttggtgagag cttcacagtg cagcggcgag                                        270
//