spacer

EBI Dbfetch

ID   AM492197; SV 1; linear; genomic DNA; STD; HUM; 3353 BP.
XX
AC   AM492197;
XX
DT   21-MAR-2007 (Rel. 91, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 2)
XX
DE   Homo sapiens HLA-B gene for MHC class I antigen, HLA-B*1801new allele,
DE   exons 1-7
XX
KW   HLA-B gene; HLA-B*1801new allele; human leucocyte antigen B;
KW   major histocompatibility complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-3353
RA   Cox S.T.;
RT   ;
RL   Submitted (06-FEB-2007) to the INSDC.
RL   Cox S.T., The Royal Free Hospital, Anthony Nolan Research Institute, Pond
RL   Street, Hampstead, London, NW3 2QG, UNITED KINGDOM.
XX
RN   [2]
RA   Cox S.T.;
RT   "New HLA allele";
RL   Unpublished.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3353
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             join(285..357,486..755,1002..1277,1850..2125,2230..2346,
FT                   2788..2820,2927..2970)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*1801new"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:A4FRG1"
FT                   /db_xref="IMGT/HLA:B*18:26"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:A4FRG1"
FT                   /protein_id="CAM33600.1"
FT                   /translation="MRVTAPRTLLLLLWGAVALTETWAGSHSMRYFHTSVSRPGRGEPR
FT                   FISVGYVDGTQFVRFDSDAASPRTEPRAPWIEQEGPEYWDRNTQISKTNTQTYRESLRN
FT                   LRGYYNQSEAGSHTLQRMYGCDVGPDGRLLRGHNQYAYDGKDYIALNEDLSSWTAADTA
FT                   AQITQRKWEAARVAEQLRAYLEGTCVEWLRRHLENGKETLQRADPPKTHVTHHPISDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQSTIPIVGIVAGLAVLAVVVIGAVVATVMCRRKSSGGK
FT                   GGSYSQAASSDSAQGSDVSLTA"
FT   exon            285..357
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*1801new"
FT                   /number=1
FT   intron          358..485
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*1801new"
FT                   /number=1
FT   exon            486..755
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*1801new"
FT                   /number=2
FT   intron          756..1001
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*1801new"
FT                   /number=2
FT   exon            1002..1277
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*1801new"
FT                   /number=3
FT   variation       1070
FT                   /allele="HLA-B*1801"
FT                   /replace="g"
FT                   /compare=AJ310507.2
FT   variation       1077
FT                   /allele="HLA-B*1801"
FT                   /replace="c"
FT                   /compare=AJ310507.2
FT   intron          1278..1849
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*1801new"
FT                   /number=3
FT   exon            1850..2125
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*1801new"
FT                   /number=4
FT   intron          2126..2229
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*1801new"
FT                   /number=4
FT   exon            2230..2346
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*1801new"
FT                   /number=5
FT   intron          2347..2787
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*1801new"
FT                   /number=5
FT   exon            2788..2820
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*1801new"
FT                   /number=6
FT   intron          2821..2926
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*1801new"
FT                   /number=6
FT   exon            2927..2970
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*1801new"
FT                   /number=7
XX
SQ   Sequence 3353 BP; 622 A; 987 C; 1045 G; 699 T; 0 other;
     gatcaggacg aagtcccagg ccccgggcgg ggctctcagg gtctcaggct ccgagagcct        60
     tgtctgcatt ggggaggcgc agcattgggg attccccact cccacgagtt tcacttcttc       120
     tcccaaccta tgtcgggtcc ttcttccagg atactcgtga cgcgtcccca tttcccactc       180
     ccattgggtg tcgggtgtct agagaagcca atcagtgtcg ccggggtccc agttctaaag       240
     tccccacgca cccacccgga ctcagaatct cctcagacgc cgagatgcgg gtcacggcgc       300
     cccgaaccct cctcctgctg ctctgggggg cagtggccct gaccgagacc tgggctggtg       360
     agtgcggggt cggcagggaa atggcctctg tggggaggag cgaggggacc gcaggcgggg       420
     gcgcaggacc cggggagccg cgccgggagg agggtcgggc gggtctcagc ccctccttgc       480
     cccaggctcc cactccatga ggtatttcca cacctccgtg tcccggcccg gccgcgggga       540
     gccccgcttc atctcagtgg gctacgtgga cggcacccag ttcgtgaggt tcgacagcga       600
     cgccgcgagt ccgaggacgg agccccgggc gccgtggata gagcaagagg ggccggagta       660
     ttgggaccgg aacacacaga tctccaagac caacacacag acttaccgag agagcctgcg       720
     gaacctgcgc ggctactaca accagagcga ggccggtgag tgaccccggc ccggggcgca       780
     ggtcacgact ccccatcccc cacgtacggc ccgggtcgcc ccgagtctcc gggtccgaga       840
     tccgcccccc tgaggccgcg ggacccgccc agaccctcga ccggcgagag ccccaggcgc       900
     gtttacccgg tttcattttc agttgaggcc aaaatccccg cgggttggtc ggggcggggc       960
     ggggctcggg gggacggggc tgaccgcggg gccggggcca gggtctcaca ccctccagag      1020
     gatgtacggc tgcgacgtgg ggccggacgg gcgcctcctc cgcgggcata accagtacgc      1080
     ctacgacggc aaggattaca tcgccctgaa cgaggacctg agctcctgga ccgcggcgga      1140
     caccgcggct cagatcaccc agcgcaagtg ggaggcggcc cgtgtggcgg agcagctgag      1200
     agcctacctg gagggcacgt gcgtggagtg gctccgcaga cacctggaga acgggaagga      1260
     gacgctgcag cgcgcgggta ccaggggcag tggggagcct tccccatctc ctataggtcg      1320
     ccggggatgg cctcccacga gaagaggagg aaaatgggat cagcgctaga atgtcgccct      1380
     cccttgaatg gagaatggca tgagttttcc tgagtttcct ctgagggccc cctcttctct      1440
     ctaggacaat taagggatga cgtctctgag gaaatggagg ggaagacagt ccctagaata      1500
     ctgatcaggg gtcccctttg acccctgcag cagccttggg aaccatgact tttcctctca      1560
     ggccttgttc tctgcctcac actcagtgtg tttggggctc tgattccagc acttctgagt      1620
     cactttacct ccactcagat caggagcaga agtctctgtt ccccgctcag agactcgaac      1680
     tttccaatga atagattatc ccaggtgcct gcgtccaggc tggtgtctgg gttctgtgcc      1740
     ccttccccac cccaggtgtc ctgtccattc tcaggctggt cacatgggtg gtcctagggt      1800
     gtcccatgag agatgcaaag cgcctgaatt ttctgactct tcccatcaga ccccccaaag      1860
     acacatgtga cccaccaccc catctctgac catgaggcca ccctgaggtg ctgggccctg      1920
     ggcttctacc ctgcggagat cacactgacc tggcagcggg atggcgagga ccaaactcag      1980
     gacaccgagc ttgtggagac cagaccagca ggagatagaa ccttccagaa gtgggcagct      2040
     gtggtggtgc cttctggaga agagcagaga tacacatgcc atgtacagca tgaggggctg      2100
     ccgaagcccc tcaccctgag atggggtaag gagggggatg aggggtcata tctcttctca      2160
     gggaaagcag gagcccttct ggagcccttc agcagggtca gggcccctca tcttcccctc      2220
     ctttcccaga gccatcttcc cagtccacca tccccatcgt gggcattgtt gctggcctgg      2280
     ctgtcctagc agttgtggtc atcggagctg tggtcgctac tgtgatgtgt aggaggaaga      2340
     gctcaggtag ggaaggggtg aggggtgggg tctgggtttt cttgtcccac tgggggtttc      2400
     aagccccagg tagaagtgtt ccctgcctca ttactgggaa gcagcatcca cacaggggct      2460
     aacacagcct gggaccctgt gtgccagcac ttactctttt gtgcagcaca tgtgacaatg      2520
     aaggacggat gtatcacctt gatggttgtg gtgttggggt cctgattcca gcattcatga      2580
     gtcaggggaa ggtccctgct aaggacagac cttaggaggg cagttggtcc aggacccaca      2640
     cttgctttcc tcgtgtttcc tgatcctgcc ttgggtctgt agtcatactt ctggaaattc      2700
     cttttggttc caagacgagg aggttcctct aagatctcat ggccctgctt cctcccagtc      2760
     ccctcacagg acattttctt cccacaggtg gaaaaggagg gagctactct caggctgcgt      2820
     gtaagtggtg ggggtgggag tgtggaggag ctcacccacc ccataattcc tcctgtccca      2880
     cgtctcctgc gggctctgac caggtcctgt ttttgttcta ctccagccag cgacagtgcc      2940
     cagggctctg atgtgtctct cacagcttga aaaggtgaga ttcttggggt ctagagtggg      3000
     cgggggggcg gggagggggc agaggggaaa ggcctgggta atggagattc tttgattggg      3060
     atgtttcgcg tgtgtggtgg gctgttcaga gtgtcatcac ttaccatgac taaccagaat      3120
     ttgttcatga ctgttgtttt ctgtagcctg agacagctgt cttgtgaggg accgagatgc      3180
     aggatttctt cacgcctccc ctttgtgact tcaagagcct ctggcatctc tttctgcaaa      3240
     ggcacctgaa tgtgtctgcg tccctgttag cataatgtga ggaggtggag agacagctca      3300
     cccccgtgtc caccgtgacc cctgttcgca tgctgacctg tgtttcctcc cca             3353
//


spacer
spacer