spacer

EBI Dbfetch

ID   AM492196; SV 1; linear; genomic DNA; STD; HUM; 3352 BP.
XX
AC   AM492196;
XX
DT   21-MAR-2007 (Rel. 91, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 2)
XX
DE   Homo sapiens HLA-B gene for MHC class I antigen, HLA-B*0801new allele,
DE   exons 1-7
XX
KW   HLA-B gene; HLA-B*0801new allele; human leucocyte antigen B;
KW   major histocompatibility complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-3352
RA   Cox S.T.;
RT   ;
RL   Submitted (06-FEB-2007) to the INSDC.
RL   Cox S.T., The Royal Free Hospital, Anthony Nolan Research Institute, Pond
RL   Street, Hampstead, London, NW3 2QG, UNITED KINGDOM.
XX
RN   [2]
RA   Cox S.T.;
RT   "B*08XX new";
RL   Unpublished.
XX
DR   MD5; 57829c07c024ff00e6046f3d3359c678.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3352
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             join(285..357,486..755,1002..1277,1850..2125,2219..2335,
FT                   2777..2809,2916..2959)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*0801new"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:A4FRG0"
FT                   /db_xref="IMGT/HLA:B*08:33"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:A4FRG0"
FT                   /protein_id="CAM33599.1"
FT                   /translation="MLVMAPRTVLLLLSAALALTETWAGSHSMRYFDTAMSRPGRGEPR
FT                   FISVGYVDDTQFVRFDSDAASPREEPRAPWIEQEGPEYWDRNTQIFKTNTQTDRESLRN
FT                   LRGYYNQSEAGSHTLQSLYGCDVGPDGRLLRGHNQYAYDGKDYIALNEDLRSWTAADTA
FT                   AQITQRKWEAARVAEQDRAYLEGTCVEWLRRYLENGKDTLERADPPKTHVTHHPISDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQSTVPIVGIVAGLAVLAVVVIGAVVAAVMCRRKSSGGK
FT                   GGSYSQAACSDSAQGSDVSLTA"
FT   exon            285..357
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*0801new"
FT                   /number=1
FT   intron          358..485
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*0801new"
FT                   /number=1
FT   exon            486..755
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*0801new"
FT                   /number=2
FT   intron          756..1001
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*0801new"
FT                   /number=2
FT   exon            1002..1277
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*0801new"
FT                   /number=3
FT   intron          1278..1849
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*0801new"
FT                   /number=3
FT   exon            1850..2125
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*0801new"
FT                   /number=4
FT   intron          2126..2218
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*0801new"
FT                   /number=4
FT   exon            2219..2335
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*0801new"
FT                   /number=5
FT   intron          2336..2776
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*0801new"
FT                   /number=5
FT   exon            2777..2809
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*0801new"
FT                   /number=6
FT   intron          2810..2915
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*0801new"
FT                   /number=6
FT   exon            2916..2959
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*0801new"
FT                   /number=7
XX
SQ   Sequence 3352 BP; 614 A; 979 C; 1055 G; 704 T; 0 other;
     gatcaggacg aagtcccagg tcccggacgg ggctctcagg gtctcaggct ccgagggccg        60
     cgtctgcaat ggggaggcgc agcgttgggg attccccact cccctgagtt tcacttcttc       120
     tcccaacttg tgtcgggtcc ttcttccagg atactcgtga cgcatcccca cttcccactc       180
     ccattgggtg tcggatatct agagaagcca atcagcgtcg ccggggtccc agttctaaag       240
     tccccacgca cccacccgga ctcagagtct cctcagacgc cgagatgctg gtcatggcgc       300
     cccgaaccgt cctcctgctg ctctcggcgg ccctggccct gaccgagacc tgggccggtg       360
     agtgcgggtc gggagggaaa tggcctctgc cgggaggagc gaggggaccg caggcggggg       420
     cgcaggacct gaggagccgc gccgggagga gggtcgggcg ggtctcagcc cctcctcgcc       480
     cccaggctcc cactccatga ggtatttcga caccgccatg tcccggcccg gccgcgggga       540
     gccccgcttc atctcagtgg gctacgtgga cgacacgcag ttcgtgaggt tcgacagcga       600
     cgccgcgagt ccgagagagg agccgcgggc gccgtggata gagcaggagg ggccggagta       660
     ttgggaccgg aacacacaga tcttcaagac caacacacag actgaccgag agagcctgcg       720
     gaacctgcgc ggctactaca accagagcga ggccggtgag tgaccccggc ccggggcgca       780
     ggtcacgact ccccatcccc cacggacggc ccgggtcgcc ccgagtctcc gggtccgaga       840
     tccgcctccc tgaggccgcg ggacccgccc agaccctcga ccggcgagag ccccaggcgc       900
     gtttacccgg tttcattttc agttgaggcc aaaatccccg cgggttggtc ggggcggggc       960
     ggggctcggg gggacggggc tgaccgcggg gccggggcca gggtctcaca ccctccagag      1020
     cttgtacggc tgcgacgtgg ggccggacgg gcgcctcctc cgcgggcata accagtacgc      1080
     ctacgacggc aaggattaca tcgccctgaa cgaggacctg cgctcctgga ccgcggcgga      1140
     caccgcggct cagatcaccc agcgcaagtg ggaggcggcc cgtgtggcgg agcaggacag      1200
     agcctacctg gagggcacgt gcgtggagtg gctccgcaga tacctggaga acgggaagga      1260
     cacgctggag cgcgcgggta ccaggggcag tggggagcct tccccatctc ctataggtcg      1320
     ccggggatgg cctcccacga gaagaggagg aaaatgggat cagcgctaga atgtcgccct      1380
     cccttgaatg gagaatggca tgagttttcc tgagtttcct ctgagggccc cctcttctct      1440
     ctagacaatt aagggatgac gtctctgagg aaatggaggg gaagacagtc cctagaatac      1500
     tgatcagggg tcccctttga cccctgcagc agccttggga accgtgactt ttcctctcag      1560
     gccttgttct ctgcctcaca ctcagtgtgt ttggggctct gattccagca cttctgagtc      1620
     actttacctc cactcagatc aggagcagaa gtccctgttc cccgctcaga gactcgaact      1680
     ttccaatgaa taggagatta tcccaggtgc ctgcatccgc tggtgtctgg gttctgtgcc      1740
     ccttccccac cccaggtgtc ctgtccattc tcaggctggt cacatgggtg gtcctagggt      1800
     gtgccatgag agatgcaaag cgcctgaatt ttctgactct tcccatcaga ccccccaaag      1860
     acacacgtga cccaccaccc catctctgac catgaggcca ccctgaggtg ctgggccctg      1920
     ggcttctacc ctgcggagat cacactgacc tggcagcggg atggcgagga ccaaactcag      1980
     gacactgagc ttgtggagac cagaccagca ggagatagaa ccttccagaa gtgggcagct      2040
     gtggtggtgc cttctggaga agagcagaga tacacatgcc atgtacagca tgaggggctg      2100
     ccgaagcccc tcaccctgag atggggtaag gagggggatg aggggtcata tctcttctca      2160
     gggaaagcag gagcccttca gcagggtcag ggcccctcat cttcccctcc tttcccagag      2220
     ccgtcttccc agtccaccgt ccccatcgtg ggcattgttg ctggcctggc tgtcctagca      2280
     gttgtggtca tcggagctgt ggtcgctgct gtgatgtgta ggaggaagag ctcaggtagg      2340
     gaaggggtga ggggtggggt ctgggttttc ttgtcccact gggggtttca agccccaggt      2400
     agaagtgttc cctgcctcat tactgggatg cagcatccac acaggggcta acgcagcctg      2460
     ggaccctgtg tgccagcact tactcttttg tgcagcacat gtgacaatga aggacggatg      2520
     tatcaccttg gtggttgtgg tgttggggtc ctgattccag cattcatgag tcaggggaag      2580
     gtccctgcta aggacagacc ttaggagggc agttggtcca ggacccacac ttgctttcct      2640
     cgtgtttcct gatcctgcct tgggtctgta gtcatacttc tggaaattcc ttttgggtcc      2700
     aagacgagga ggttcctcta agatctcatg gccctgcttc ctcccagtcc cctcacaggg      2760
     cattttcttc ccacaggtgg aaaaggaggg agctactctc aggctgcgtg taagtgatgg      2820
     gggtgggagt gtggaggagc tcacccaccc cataattcct cctgtcccac gtctcctgcg      2880
     ggctctgacc aggtcctgtt tttgttctac tccaggcagc gacagtgccc agggctctga      2940
     tgtgtctctc acagcttgaa aaggtgagat tcttggggtc tagagtgggt ggggtggcgg      3000
     gtctgggggt gggtggggca gtggggaaag gcctgggtaa tggagattct ttgattggga      3060
     tgtttcgcgt gtgtggtggg ctgtttagag tgtcatcact taccatgact aaccagaatt      3120
     tgttcatgac tgttgttttc tgtagcctga gacagctgtc ttgtgaggga ctgagatgca      3180
     ggatttcttc acgcctcccc tttgtgactt caagagcctc tggcatctct ttctgcaaag      3240
     gcacctgaat gtgtctgcgt ccctgttagc ataatgtgag gaggtggaga gacagcccac      3300
     ccttgtgtcc actgtgaccc ctgttcgcat gctgacctgt gtttcctccc ca              3352
//


spacer
spacer