spacer

EBI Dbfetch

ID   AM491776; SV 1; linear; genomic DNA; STD; HUM; 3312 BP.
XX
AC   AM491776;
XX
DT   10-FEB-2007 (Rel. 90, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 2)
XX
DE   Homo sapiens HLA-B gene for MHC class I antigen, HLA-B*4014new allele,
DE   exons 1-7
XX
KW   HLA-B gene; HLA-B*4014new allele; human leucocyte antigen B;
KW   major histocompatibility complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-3312
RA   Cox S.T.;
RT   ;
RL   Submitted (07-FEB-2007) to the INSDC.
RL   Cox S.T., The Royal Free Hospital, Anthony Nolan Research Institute, Pond
RL   Street, Hampstead, London, NW3 2QG, UNITED KINGDOM.
XX
RN   [2]
RA   Cox S.T.;
RT   "New HLA allele";
RL   Unpublished.
XX
DR   MD5; 788537c7f43a5042670096c906f49528.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3312
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   mRNA            join(<245..317,446..715,961..1236,1810..2085,2179..2295,
FT                   2737..2769,2876..>2919)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*4014new"
FT   CDS             join(245..317,446..715,961..1236,1810..2085,2179..2295,
FT                   2737..2769,2876..2919)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*4014new"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:A2VBB7"
FT                   /db_xref="IMGT/HLA:B*40:72:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:A2VBB7"
FT                   /protein_id="CAM33395.1"
FT                   /translation="MRVTAPRTVLLLLSAALALTETWAGSHSMRYFHTAMSRPGRGEPR
FT                   FITVGYVDDTLFVRFDSDATSPRKEPRAPWIEQEGPEYWDRETQISKTNTQTYRESLRN
FT                   LRGYYNQSEAGSHTLQRMYGCDVGPDGRLLRGHNQYAYDGKDYIALNEDLRSWTAADTA
FT                   AQITQRKLEAARVAEQLRAYLEGECVEWLRRYLENGKDKLERADPPKTHVTHHPISDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQSTVPIVGIVAGLAVLAVVVIGAVVAAVMCRRKSSGGK
FT                   GGSYSQAACSDSAQGSDVSLTA"
FT   exon            <245..317
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*4014new"
FT                   /number=1
FT   intron          318..445
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*4014new"
FT                   /number=1
FT   exon            446..715
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*4014new"
FT                   /number=2
FT   intron          716..960
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*4014new"
FT                   /number=2
FT   exon            961..1236
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*4014new"
FT                   /number=3
FT   variation       1129
FT                   /allele="HLA-B*401401"
FT                   /replace="g"
FT                   /compare=AF002274.1
FT   intron          1237..1809
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*4014new"
FT                   /number=3
FT   exon            1810..2085
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*4014new"
FT                   /number=4
FT   intron          2086..2178
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*4014new"
FT                   /number=4
FT   exon            2179..2295
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*4014new"
FT                   /number=5
FT   intron          2296..2736
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*4014new"
FT                   /number=5
FT   exon            2737..2769
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*4014new"
FT                   /number=6
FT   intron          2770..2875
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*4014new"
FT                   /number=6
FT   exon            2876..>2919
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*4014new"
FT                   /number=7
XX
SQ   Sequence 3312 BP; 611 A; 962 C; 1038 G; 701 T; 0 other;
     gtctcaggct ccgagggccg cgtctgcaat ggggaggcgc agcgttgggg attccccact        60
     cccacgagtt tcacttcttc tcccaaccta tgtcgggtcc ttcttccagg atactcgtga       120
     cgcgtcccca tttcccactc ccattgggtg tcgggtgtct agagaagcca atcagcgtcg       180
     ccgtggtccc agttctaaag tccccacgca cccacccgga ctcagaatct cctcagacgc       240
     cgagatgcgg gtcacggcac cccgaaccgt cctcctgctg ctctcggcgg ccctggccct       300
     gaccgagacc tgggccggtg agtgcgggtc ggcagggaaa tggcctctgt ggggaggagc       360
     gaggggaccg caggcggggg cgcaggaccc ggggagccgc gccgggagga gggtcgggcg       420
     ggtctcagct cctcctcgcc cccaggctcc cactccatga ggtatttcca caccgccatg       480
     tcccggcccg gccgcgggga gccccgcttc atcaccgtgg gctacgtgga cgacacgctg       540
     ttcgtgaggt tcgacagcga cgccacgagt ccgaggaagg agccgcgggc gccatggata       600
     gagcaggagg ggccggagta ttgggaccgg gagacacaga tctccaagac caacacacag       660
     acttaccgag agagcctgcg gaacctgcgc ggctactaca accagagcga ggccggtgag       720
     tgaccccggc ccggggcgca ggtcacgact ccccatcccc cacgtacggc ccgggtcgcc       780
     ccgagtctcc gggtccgaga tccgaccccc tgaggccgcg ggacccgccc agaccctcga       840
     ccggcgagag ccccaggcgc gtttacccgg tttcattttc agttgaggcc aaaatccccg       900
     cgggttggtc ggggcggggc ggggctcggg ggactgggct gaccgcgggg ccggggccag       960
     ggtctcacac cctccagagg atgtacggct gcgacgtggg gccggacggg cgcctcctcc      1020
     gcgggcataa ccagtacgcc tacgacggca aggattacat cgccctgaac gaggacctgc      1080
     gctcctggac cgcggcggac accgcggctc agatcaccca gcgcaagttg gaggcggccc      1140
     gtgtggcgga gcagctgaga gcctacctgg agggcgagtg cgtggagtgg ctccgcagat      1200
     acctggagaa cgggaaggac aagctggagc gcgctggtac caggggcagg gggagccttc      1260
     cccatctcct ataggtcgcc ggggatggcc tcccacgaga agaggaggaa aatgggatca      1320
     gcgctagaat gtcgccctcc gttgaatgga gaatggcatg agttttcctg agtttcctct      1380
     gagggccccc tcttctctct agacaattaa ggaatgacgt ctctgaggaa atggagggga      1440
     agacagtccc tagaatactg atcaggggtc ccctttgacc cctgcagcag ccttgggaac      1500
     cgtgactttt cctctcaggc cttgttctct gcctcacact cagtgtgttt ggggctctga      1560
     ttccagcact tctgagtcac tttacctcca ctcagatcag gagcagaagt ccctgttccc      1620
     cgctcagaga ctcgaacttt ccaatgaata ggagattatc ccaggtgcct gcgtccaggc      1680
     tggtgtctgg gttctgtgcc ccttccccac cccaggtgtc ctgtccattc tcaggctggt      1740
     cacatgggtg gtcctagggt gtcccatgaa agatgcaaag cgcctgaatt ttctgactct      1800
     tcccatcaga ccccccaaag acacacgtga cccaccaccc catctctgac catgaggcca      1860
     ccctgaggtg ctgggccctg ggtttctacc ctgcggagat cacactgacc tggcagcggg      1920
     atggcgagga ccaaactcag gacactgagc ttgtggagac cagaccagca ggagatagaa      1980
     ccttccagaa gtgggcagct gtggtggtgc cttctggaga agagcagaga tacacatgcc      2040
     atgtacagca tgaggggctg ccgaagcccc tcaccctgag atggggtaag gagggggatg      2100
     aggggtcata tctcttctca gggaaagcag gagcccttca gcagggtcag ggcccctcat      2160
     cttcccctcc tttcccagag ccgtcttccc agtccaccgt ccccatcgtg ggcattgttg      2220
     ctggcctggc tgtcctagca gttgtggtca tcggagctgt ggtcgctgct gtgatgtgta      2280
     ggaggaagag ttcaggtagg gaaggggtga ggggtggggt ctgggttttc ttgtcccact      2340
     gggggtttca agccccaggt agaagtgttc cctgcctcat tactgggaag cagcatgcac      2400
     acaggggcta acgcagcctg ggaccctgtg tgccagcact tactcttttg tgcagcacat      2460
     gtgacaatga aggatggatg tatcaccttg atggttgtgg tgttggggtc ctgattccag      2520
     cattcatgag tcaggggaag gtccctgcta aggacagacc ttaggagggc agttggtcca      2580
     ggacccacac ttgctttcct cgtgtttcct gatcctgccc tgggtctgta gtcatacttc      2640
     tggaaattcc ttttgggtcc aagactagga ggttcctcta agatctcatg gccctgcttc      2700
     ctcccagtgc cctcacagga cattttcttc ccacaggtgg aaaaggaggg agctactctc      2760
     aggctgcgtg taagtggtgg gggtgggagt gtggaggagc tcacccaccc cataattcct      2820
     cctgtcccac gtctcctgcg ggctctgacc aggtcctgtt tttgttctac tccaggcagc      2880
     gacagtgccc agggctctga tgtgtctctc acagcttgaa aaggtgagat tcttggggtc      2940
     tagagtgggt ggggtggcgg gtctgggggt gggtggggca gaggggaaag gcctgggtaa      3000
     tggggattct ttgattggga tgtttcgcgt gtgtggtggg ctgtttagag tgtcatcgct      3060
     taccatgact aaccagaatt tgttcatgac tgttgttttc tgtagcctga gacagctgtc      3120
     ttgtgaggga ctgagatgca ggatttcttc acgcctcccc tttgtgactt caagagcctc      3180
     tggcatctct ttctgcaaag gcacctgaat gtgtctgcgt ccctgttagc ataatgtgag      3240
     gaggtggaga gacagcccac ccttgtgtcc actgtgaccc ctgttcgcat gctgacctgt      3300
     gtttcctccc ca                                                          3312
//


spacer
spacer